Immunohistochemistry (IHC) : Human lung adenocarcinoma stained with anti-TTF-1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

rabbit anti-TTF-1/NKX2.1 monoclonal antibody (ZR176) 6397

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to TTF-1/NKX2.1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Normal thyroid or lung
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6397parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Lung/Mediastinum Pathology, TTF-1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-TTF-1/NKX2.1 monoclonal antibody ZR176 6397

antibody
Database link: human P43699
Tested applications IHC
Recommended dilutions Concentrated 1:200
Application Notes Positive control: Normal thyroid or lung
Immunogen Recombinant TTF-1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens NKX2-1 Homeobox protein Nkx-2.1
Protein names Homeobox protein Nkx-2.1
Alternative names Homeobox protein NK-2 homolog A, Thyroid nuclear factor 1, Thyroid transcription factor 1, Thyroid-specific enhancer-binding protein
Gene names NKX2-1
Protein family Belongs to the NK-2 homeobox family
Function Transcription factor that binds and activates the promoter of thyroid specific genes such as thyroglobulin, thyroperoxidase, and thyrotropin receptor. Crucial in the maintenance of the thyroid differentiation phenotype. May play a role in lung development and surfactant homeostasis. Forms a regulatory loop with GRHL2 that coordinates lung epithelial cell morphogenesis and differentiation. Activates the transcription of GNRHR and plays a role in enhancing the circadian oscillation of its gene expression. Represses the transcription of the circadian transcriptional repressor NR1D1 (By similarity)
Subcellular location Nucleus
Structure Interacts with WWTR1
Post-translational modification Phosphorylated on serine residues by STK3/MST2
Involvement in disease Chorea, hereditary benign A rare autosomal dominant movement disorder, defined by early onset in childhood, a stable or non-progressive course of chorea, and no mental deterioration. Chorea is characterized by involuntary, forcible, rapid, jerky movements that may be subtle or become confluent, markedly altering normal patterns of movement. Choreoathetosis and congenital hypothyroidism with or without pulmonary dysfunction An autosomal dominant disorder that manifests in infancy with neurological disturbances, hypothyroidism, and respiratory problems. It is characterized by movement abnormalities beginning with muscular hypotonia followed by the development of chorea, athetosis, dystonia, ataxia, and dysarthria. Thyroid cancer, non-medullary, 1 A form of non-medullary thyroid cancer (NMTC), a cancer characterized by tumors originating from the thyroid follicular cells. NMTCs represent approximately 95% of all cases of thyroid cancer and are classified into papillary, follicular, Hurthle cell, and anaplastic neoplasms.
Keywords Activator, Alternative splicing, Biological rhythms, Congenital hypothyroidism, Disease variant, DNA-binding, Homeobox, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repressor, Transcription, Transcription regulation
Sequence MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGH HGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDP RFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRF KQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGG GTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAA AAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTM SCSTLLYGRTW
UniProt accession: P43699

Data

Human lung adenocarcinoma stained with anti-TTF-1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species is the rabbit anti-TTF-1/NKX2.1 monoclonal antibody (ZR176) reactive with?

This antibody is reactive with human species.

Which applications is the rabbit anti-TTF-1/NKX2.1 monoclonal antibody (ZR176) suitable for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-TTF-1/NKX2.1 antibody be stored to maintain its stability?

Store the antibody at 2-8°C for short term and at -20°C for longer term storage, avoiding freeze/thaw cycles.

What is the recommended dilution for using the concentrated form of this antibody in IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is 1:200.

What is the immunogen used to generate the rabbit anti-TTF-1/NKX2.1 monoclonal antibody (ZR176)?

The immunogen is recombinant TTF-1 protein.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.