Skip to content

rabbit anti-p40 monoclonal antibody (ZR8) 6310

Price range: $160.00 through $528.00

Antibody summary

  • Rabbit monoclonal to p40
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG
  • Control: Lung squamous cell carcinoma
  • Visualization: Nuclear
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-p40 monoclonal antibody ZR8 6310

antibody
Database link:
human Q9H3D4
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Lung squamous cell carcinoma
Immunogen
Synthesized polypeptides from N-terminal domain of p63
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens TP63
Tumor protein 63
Protein names
Tumor protein 63
Alternative names
Chronic ulcerative stomatitis protein, Keratinocyte transcription factor KET, Transformation-related protein 63, Tumor protein p73-like, p40, p51
Gene names
TP63
Protein family
Belongs to the p53 family
Function
Acts as a sequence specific DNA binding transcriptional activator or repressor. The isoforms contain a varying set of transactivation and auto-regulating transactivation inhibiting domains thus showing an isoform specific activity. Isoform 2 activates RIPK4 transcription. May be required in conjunction with TP73/p73 for initiation of p53/TP53 dependent apoptosis in response to genotoxic insults and the presence of activated oncogenes. Involved in Notch signaling by probably inducing JAG1 and JAG2. Plays a role in the regulation of epithelial morphogenesis. The ratio of DeltaN-type and TA*-type isoforms may govern the maintenance of epithelial stem cell compartments and regulate the initiation of epithelial stratification from the undifferentiated embryonal ectoderm. Required for limb formation from the apical ectodermal ridge. Activates transcription of the p21 promoter
Subcellular location
Nucleus
Structure
Binds DNA as a homotetramer. Isoform composition of the tetramer may determine transactivation activity. Isoforms Alpha and Gamma interact with HIPK2. Interacts with SSRP1, leading to stimulate coactivator activity. Isoform 1 and isoform 2 interact with WWP1. Interacts with PDS5A. Isoform 5 (via activation domain) interacts with NOC2L
Post-translational modification
May be sumoylated
Ubiquitinated. Polyubiquitination involves WWP1 and leads to proteasomal degradation of this protein
Involvement in disease
Acro-dermato-ungual-lacrimal-tooth syndrome
A form of ectodermal dysplasia. Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. ADULT syndrome involves ectrodactyly, syndactyly, finger- and toenail dysplasia, hypoplastic breasts and nipples, intensive freckling, lacrimal duct atresia, frontal alopecia, primary hypodontia and loss of permanent teeth. ADULT syndrome differs significantly from EEC3 syndrome by the absence of facial clefting. Inheritance is autosomal dominant.

Ankyloblepharon-ectodermal defects-cleft lip/palate
An autosomal dominant condition characterized by congenital ectodermal dysplasia with coarse, wiry, sparse hair, dystrophic nails, slight hypohidrosis, scalp infections, ankyloblepharon filiform adnatum, maxillary hypoplasia, hypodontia and cleft lip/palate.

Ectrodactyly, ectodermal dysplasia, and cleft lip/palate syndrome 3
A form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. It is an autosomal dominant syndrome characterized by ectrodactyly of hands and feet, ectodermal dysplasia and facial clefting.

Split-hand/foot malformation 4
A limb malformation involving the central rays of the autopod and presenting with syndactyly, median clefts of the hands and feet, and aplasia and/or hypoplasia of the phalanges, metacarpals, and metatarsals. Some patients have been found to have intellectual disability, ectodermal and craniofacial findings, and orofacial clefting.

Limb-mammary syndrome
Characterized by ectrodactyly, cleft palate and mammary-gland abnormalities.

Rapp-Hodgkin syndrome
A form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. Characterized by the combination of anhidrotic ectodermal dysplasia, cleft lip, and cleft palate. The clinical syndrome is comprised of a characteristic facies (narrow nose and small mouth), wiry, slow-growing, and uncombable hair, sparse eyelashes and eyebrows, obstructed lacrimal puncta/epiphora, bilateral stenosis of external auditory canals, microsomia, hypodontia, cone-shaped incisors, enamel hypoplasia, dystrophic nails, and cleft lip/cleft palate. RHS inheritance is autosomal dominant.

Orofacial cleft 8
A birth defect consisting of cleft lips with or without cleft palate. Cleft lips are associated with cleft palate in two-third of cases. A cleft lip can occur on one or both sides and range in severity from a simple notch in the upper lip to a complete opening in the lip extending into the floor of the nostril and involving the upper gum.

Premature ovarian failure 21
A form of premature ovarian failure, an ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol. POF21 inheritance is autosomal dominant.

Keywords
3D-structure, Activator, Alternative promoter usage, Alternative splicing, Apoptosis, Developmental protein, Disease variant, DNA-binding, Ectodermal dysplasia, Isopeptide bond, Metal-binding, Notch signaling pathway, Nucleus, Premature ovarian failure, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation, Zinc
Sequence
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWD FLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSM DQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVS FQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEV VKRCPNHELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGRDRKADEDSIR KQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKES LELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQ LINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPP PPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWND FNFDMDARRNKQQRIKEEGE
UniProt accession: Q9H3D4

Data

Human tonsil stained with anti-p40 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of squamous epithelium..
Human tonsil stained with anti-p40 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of squamous epithelium..

FAQ & Publications

Frequently Asked Questions
What is the recommended application for the rabbit anti-p40 monoclonal antibody (ZR8) 6310?
This antibody is suitable for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples.
How should the rabbit anti-p40 monoclonal antibody be stored to maintain its stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, avoiding repeated freeze/thaw cycles.
Which species does the rabbit anti-p40 monoclonal antibody (ZR8) 6310 specifically react with?
This antibody specifically reacts with human tissues.
What is the host species and clonality of the anti-p40 antibody (ZR8) 6310?
The antibody is a rabbit monoclonal antibody.
What are the available sizes and concentrations for this rabbit anti-p40 monoclonal antibody?
It is available as 0.1 mL, 0.5 mL, and 1.0 mL in concentrated form, and also as a 7 mL prediluted solution.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.