Immunohistochemistry (IHC) : Human breast carcinoma stained with anti-Glut-1 using peroxidase-conjugate and DAB chromogen. Note membranous staining of tumor cells.

rabbit anti-GLUT-1 monoclonal antibody (ZR308) 6197

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to GLUT-1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Adenocarcinoma
Visualization: Cell surface
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6197parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, GLUT-1, Lung/Mediastinum Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-GLUT-1 monoclonal antibody ZR308 6197

antibody
Database link: human P11166
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Adenocarcinoma
Immunogen Recombinant full-length human GLUT-1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens SLC2A1 Solute carrier family 2, facilitated glucose transporter member 1
Protein names Solute carrier family 2, facilitated glucose transporter member 1
Alternative names Glucose transporter type 1, erythrocyte/brain, HepG2 glucose transporter
Gene names SLC2A1
Protein family Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily
Function Facilitative glucose transporter, which is responsible for constitutive or basal glucose uptake (PubMed:10227690, PubMed:10954735, PubMed:18245775, PubMed:19449892, PubMed:25982116, PubMed:27078104, PubMed:32860739). Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses (PubMed:18245775, PubMed:19449892). Most important energy carrier of the brain: present at the blood-brain barrier and assures the energy-independent, facilitative transport of glucose into the brain (PubMed:10227690). In association with BSG and NXNL1, promotes retinal cone survival by increasing glucose uptake into photoreceptors (By similarity). Required for mesendoderm differentiation (By similarity)
Catalytic activity D-glucose(out) = D-glucose(in)
Subcellular location Cell membrane, Melanosome, Photoreceptor inner segment
Structure Interacts with GIPC (via PDZ domain) (By similarity). Found in a complex with ADD2, DMTN and SLC2A1. Interacts (via C-terminus cytoplasmic region) with DMTN isoform 2 (PubMed:18347014). Interacts with SNX27; the interaction is required when endocytosed to prevent degradation in lysosomes and promote recycling to the plasma membrane (PubMed:23563491). Interacts with STOM (PubMed:23219802). Interacts with SGTA (via Gln-rich region) (By similarity). Interacts with isoform 1 of BSG (PubMed:25957687)
Post-translational modification Phosphorylation at Ser-226 by PKC promotes glucose uptake by increasing cell membrane localization
Involvement in disease GLUT1 deficiency syndrome 1 A neurologic disorder showing wide phenotypic variability. The most severe 'classic' phenotype comprises infantile-onset epileptic encephalopathy associated with delayed development, acquired microcephaly, motor incoordination, and spasticity. Onset of seizures, usually characterized by apneic episodes, staring spells, and episodic eye movements, occurs within the first 4 months of life. Other paroxysmal findings include intermittent ataxia, confusion, lethargy, sleep disturbance, and headache. Varying degrees of cognitive impairment can occur, ranging from learning disabilities to severe intellectual disability. GLUT1 deficiency syndrome 2 A clinically variable disorder characterized primarily by onset in childhood of paroxysmal exercise-induced dyskinesia. The dyskinesia involves transient abnormal involuntary movements, such as dystonia and choreoathetosis, induced by exercise or exertion, and affecting the exercised limbs. Some patients may also have epilepsy, most commonly childhood absence epilepsy. Mild intellectual disability may also occur. In some patients involuntary exertion-induced dystonic, choreoathetotic, and ballistic movements may be associated with macrocytic hemolytic anemia. Epilepsy, idiopathic generalized 12 A disorder characterized by recurring generalized seizures in the absence of detectable brain lesions and/or metabolic abnormalities. Generalized seizures arise diffusely and simultaneously from both hemispheres of the brain. Seizure types include juvenile myoclonic seizures, absence seizures, and generalized tonic-clonic seizures. In some EIG12 patients seizures may remit with age. Dystonia 9 An autosomal dominant neurologic disorder characterized by childhood onset of paroxysmal choreoathetosis and progressive spastic paraplegia. Most patients show some degree of cognitive impairment. Other variable features may include seizures, migraine headaches, and ataxia. Stomatin-deficient cryohydrocytosis with neurologic defects A rare form of stomatocytosis characterized by episodic hemolytic anemia, cold-induced red cells cation leak, erratic hyperkalemia, neonatal hyperbilirubinemia, hepatosplenomegaly, cataracts, seizures, intellectual disability, and movement disorder.
Keywords 3D-structure, Acetylation, Cataract, Cell membrane, Direct protein sequencing, Disease variant, Dystonia, Epilepsy, Glycoprotein, Hereditary hemolytic anemia, Intellectual disability, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Sugar transport, Transmembrane, Transmembrane helix, Transport
Sequence MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTT LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIM GNKDLWPLLLSIIFIPALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTHD LQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLEQ LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE ELFHPLGADSQV
UniProt accession: P11166

Data

Human breast carcinoma stained with anti-Glut-1 using peroxidase-conjugate and DAB chromogen. Note membranous staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-GLUT-1 monoclonal antibody (ZR308) 6197 react with?

This antibody reacts specifically with human tissues.

Which applications is the rabbit anti-GLUT-1 monoclonal antibody (ZR308) validated for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-GLUT-1 monoclonal antibody (ZR308) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, freeze at -20°C while avoiding repeated freeze/thaw cycles.

What is the recommended dilution range for using the concentrated rabbit anti-GLUT-1 monoclonal antibody (ZR308) in IHC?

The recommended dilution for the concentrated antibody is between 1:100 and 1:200 for immunohistochemical applications.

What is the host species and clonality of the anti-GLUT-1 antibody ZR308 6197?

The antibody is a rabbit monoclonal antibody with IgG isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.