Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human lung adenocarcinoma stained with anti-napsin A antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining carcinoma cells

rabbit anti-Napsin-A monoclonal antibody (ZR206) 6283

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Napsin-A
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Lung adenocarcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6283parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Lung/Mediastinum Pathology, monoclonal, Napsin-A

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Napsin-A monoclonal antibody ZR206 6283

antibody
Database link: human O14601
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Lung adenocarcinoma
Immunogen Recombinant human Napsin-A protein fragment (aa189-299) (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens NAPSA Napsin-A
Protein names Napsin-A
Alternative names Aspartyl protease 4, Napsin-1, TA01/TA02
Gene names NAPSA
Protein family Belongs to the peptidase A1 family
Function May be involved in processing of pneumocyte surfactant precursors
Subcellular location Secreted
Keywords Aspartyl protease, Direct protein sequencing, Disulfide bond, Glycoprotein, Hydrolase, Protease, Proteomics identification, Reference proteome, Secreted, Signal, Zymogen
Sequence MSPPPLLQPLLLLLPLLNVEPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPS PGDKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHH RFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAF AHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDP AHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALH AAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQA LDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
UniProt accession: O96009

Data

Formalin-fixed, paraffin-embedded human lung adenocarcinoma stained with anti-napsin A antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining carcinoma cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Napsin-A monoclonal antibody (ZR206) specifically react with?

This antibody specifically reacts with human tissues.

Which applications is this rabbit anti-Napsin-A monoclonal antibody validated for?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-Napsin-A monoclonal antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, and freeze/thaw cycles should be avoided.

What is the recommended dilution range for using the concentrated form of this anti-Napsin-A monoclonal antibody in IHC?

The recommended dilution for the concentrated antibody is between 1:100 and 1:200 for immunohistochemistry applications.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.