Skip to content

mouse anti-Podoplanin monoclonal antibody (ZM31) 6340

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to Podoplanin
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG1
  • Control: Mesothelioma
  • Visualization: Cytoplasmic
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Podoplanin monoclonal antibody ZM31 6340

antibody
Database link:
human Q86YL7
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Mesothelioma
Immunogen
Recombinant human Podoplanin (PDPN) protein fragment (around aa 24-126)
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG1 - Isotype Control
target relevance
Homo sapiens PDPN
Podoplanin
Protein names
Podoplanin
Alternative names
Aggrus, Glycoprotein 36, PA2.26 antigen, T1-alpha
Gene names
PDPN
Protein family
Belongs to the podoplanin family
Function
Mediates effects on cell migration and adhesion through its different partners. During development plays a role in blood and lymphatic vessels separation by binding CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation (PubMed:14522983, PubMed:15231832, PubMed:17222411, PubMed:17616532, PubMed:18215137). Interaction with CD9, on the contrary, attenuates platelet aggregation induced by PDPN (PubMed:18541721). Through MSN or EZR interaction promotes epithelial-mesenchymal transition (EMT) leading to ERZ phosphorylation and triggering RHOA activation leading to cell migration increase and invasiveness (PubMed:17046996, PubMed:21376833). Interaction with CD44 promotes directional cell migration in epithelial and tumor cells (PubMed:20962267). In lymph nodes (LNs), controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix (ECM) and contraction of the actomyosin by maintaining ERM proteins (EZR; MSN and RDX) and MYL9 activation through association with unknown transmembrane proteins. Engagement of CLEC1B by PDPN promotes FRCs relaxation by blocking lateral membrane interactions leading to reduction of ERM proteins (EZR; MSN and RDX) and MYL9 activation (By similarity). Through binding with LGALS8 may participate in connection of the lymphatic endothelium to the surrounding extracellular matrix (PubMed:19268462). In keratinocytes, induces changes in cell morphology showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion (PubMed:15515019). Controls invadopodia stability and maturation leading to efficient degradation of the extracellular matrix (ECM) in tumor cells through modulation of RHOC activity in order to activate ROCK1/ROCK2 and LIMK1/LIMK2 and inactivation of CFL1 (PubMed:25486435). Required for normal lung cell proliferation and alveolus formation at birth (By similarity). Does not function as a water channel or as a regulator of aquaporin-type water channels (PubMed:9651190). Does not have any effect on folic acid or amino acid transport (By similarity)
Subcellular location
Cytoplasm, cytosol
Structure
Homodimer (PubMed:21376833). Interacts with CLEC1B; the interaction is independent of CLEC1B glycosylation and activates CLEC1B; the interaction is dependent of sialic acid on O-glycans (PubMed:17616532, PubMed:18215137, PubMed:25458834). Interacts with CD9; this interaction is homophilic and attenuates platelet aggregation and pulmonary metastasis induced by PDPN (PubMed:18541721). Interacts with LGALS8; the interaction is glycosylation-dependent; may participate in connection of the lymphatic endothelium to the surrounding extracellular matrix (PubMed:19268462). Interacts with HSPA9 (PubMed:23541579). Interacts (via extracellular domain) with CD44; this interaction is required for PDPN-mediated directional migration and regulation of lamellipodia extension/stabilization during cell spreading and migration (PubMed:20962267). Interacts (via cytoplasmic domain) with MSN and EZR; activates RHOA and promotes epithelial-mesenchymal transition (PubMed:17046996). Interacts with CCL21; relocalized PDPN to the basolateral membrane (PubMed:14978162)
Post-translational modification
Extensively O-glycosylated. Contains sialic acid residues. O-glycosylation is necessary for platelet aggregation activity. Disialylated at Thr-52; sialic acid is critical for platelet-aggregating activity and for CLEC1B interaction (PubMed:17222411, PubMed:25458834)
The N-terminus is blocked
Cleaved by a metalloprotease within its extracellular (EC) domain, generating a membrane-bound C-terminal fragment (PCTF33) and an extracellular fragment. The resulting membrane-bound C-terminal fragment (PCTF33) is further processed between Val-150 and Val-151 by PSEN1/gamma-secretase generating the intracellular domain of podoplanin (PICD)
Keywords
3D-structure, Alternative splicing, Cell junction, Cell membrane, Cell projection, Cell shape, Cytoplasm, Developmental protein, Direct protein sequencing, Glycoprotein, Membrane, Proteomics identification, Reference proteome, Sialic acid, Signal, Transmembrane, Transmembrane helix
Sequence
MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRY KSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTT VEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP
UniProt accession: Q86YL7

Data

Human lymph node stained with anti-podoplannin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of lymphatic endothelial cells..
Human lymph node stained with anti-podoplannin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of lymphatic endothelial cells..

FAQ & Publications

Frequently Asked Questions
What species does the mouse anti-Podoplanin monoclonal antibody (ZM31) 6340 specifically react with?
This antibody specifically reacts with human Podoplanin, making it suitable for applications involving human tissue samples.
Which applications is the mouse anti-Podoplanin monoclonal antibody (ZM31) 6340 validated for?
The antibody has been tested and recommended for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with suggested dilutions of 1:100 to 1:200 when used in concentrated form.
How should the mouse anti-Podoplanin monoclonal antibody (ZM31) be stored to maintain its stability?
For short-term storage, keep the antibody at 2-8°C; for long-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.
What is the host and clonality of the anti-Podoplanin monoclonal antibody (ZM31) 6340?
This product is a mouse-derived monoclonal antibody of the IgG1 isotype, ensuring specificity and consistent performance in experimental applications.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.