Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human seminoma stained with anti-SALL4 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells

rabbit anti-SALL4 monoclonal antibody (ZR276) 6360

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to SALL4
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Seminoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6360parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, SALL4, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-SALL4 monoclonal antibody ZR276 6360

antibody
Database link: human O14601
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Seminoma
Immunogen Recombinant fragment (around aa1-185) of human MIC2 protein (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens SALL4 Sal-like protein 4
Protein names Sal-like protein 4
Alternative names Zinc finger protein 797, Zinc finger protein SALL4
Gene names SALL4
Protein family Belongs to the sal C2H2-type zinc-finger protein family
Function Transcription factor with a key role in the maintenance and self-renewal of embryonic and hematopoietic stem cells
Subcellular location Cytoplasm, Nucleus
Structure Interacts with POU5F1/OCT4 (PubMed:23012367). Interacts with NANOG (By similarity). Interacts with BEND3 (PubMed:21914818). Interacts with NSD2 (via PHD-type zinc fingers 1, 2 and 3) (By similarity). Interacts with NRBP1 (PubMed:22510880)
Post-translational modification Isoform SALL4B exists primarily as a ubiquitinated form Sumoylation with both SUMO1 and SUMO2 regulates the stability, subcellular localization, transcriptional activity, and may reduce interaction with POU5F1/OCT4
Involvement in disease Duane-radial ray syndrome Disorder characterized by the association of forearm malformations with Duane retraction syndrome. IVIC syndrome An autosomal dominant condition characterized by upper limbs anomalies (radial ray defects, carpal bones fusion), extraocular motor disturbances, congenital bilateral non-progressive mixed hearing loss. Other less consistent malformations include heart involvement, mild thrombocytopenia and leukocytosis (before age 50), shoulder girdle hypoplasia, imperforate anus, kidney malrotation or rectovaginal fistula. The IVIC syndrome is an allelic disorder of Duane-radial ray syndrome with a similar phenotype.
Keywords 3D-structure, Alternative splicing, Cytoplasm, Deafness, Disease variant, DNA-binding, Isopeptide bond, Metal-binding, Nucleus, Oncogene, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Transcription, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger
Sequence MSRRKQAKPQHINSEEDQGEQQPQQQTPEFADAAPAAPAAGELGAPVNHPGNDEVASEDE ATVKRLRREETHVCEKCCAEFFSISEFLEHKKNCTKNPPVLIMNDSEGPVPSEDFSGAVL SHQPTSPGSKDCHRENGGSSEDMKEKPDAESVVYLKTETALPPTPQDISYLAKGKVANTN VTLQALRGTKVAVNQRSADALPAPVPGANSIPWVLEQILCLQQQQLQQIQLTEQIRIQVN MWASHALHSSGAGADTLKTLGSHMSQQVSAAVALLSQKAGSQGLSLDALKQAKLPHANIP SATSSLSPGLAPFTLKPDGTRVLPNVMSRLPSALLPQAPGSVLFQSPFSTVALDTSKKGK GKPPNISAVDVKPKDEAALYKHKCKYCSKVFGTDSSLQIHLRSHTGERPFVCSVCGHRFT TKGNLKVHFHRHPQVKANPQLFAEFQDKVAAGNGIPYALSVPDPIDEPSLSLDSKPVLVT TSVGLPQNLSSGTNPKDLTGGSLPGDLQPGPSPESEGGPTLPGVGPNYNSPRAGGFQGSG TPEPGSETLKLQQLVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGERPFQCKICG RAFSTKGNLKTHLGVHRTNTSIKTQHSCPICQKKFTNAVMLQQHIRMHMGGQIPNTPLPE NPCDFTGSEPMTVGENGSTGAICHDDVIESIDVEEVSSQEAPSSSSKVPTPLPSIHSASP TLGFAMMASLDAPGKVGPAPFNLQRQGSRENGSVESDGLTNDSSSLMGDQEYQSRSPDIL ETTSFQALSPANSQAESIKSKSPDAGSKAESSENSRTEMEGRSSLPSTFIRAPPTYVKVE VPGTFVGPSTLSPGMTPLLAAQPRRQAKQHGCTRCGKNFSSASALQIHERTHTGEKPFVC NICGRAFTTKGNLKVHYMTHGANNNSARRGRKLAIENTMALLGTDGKRVSEIFPKEILAP SVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQ SGISADVEKPSATDGVPKHQFPHFLEENKIAVS
UniProt accession: Q9UJQ4

Data

Formalin-fixed, paraffin-embedded human seminoma stained with anti-SALL4 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species reactivity does the rabbit anti-SALL4 monoclonal antibody (ZR276) display?

The rabbit anti-SALL4 monoclonal antibody (ZR276) is reactive with human tissues.

Which applications is the rabbit anti-SALL4 antibody suitable for, and what is the recommended dilution?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. The recommended dilution for the concentrated antibody is between 1:100 and 1:200.

How should the rabbit anti-SALL4 monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term storage, it should be kept at -20°C. It is important to avoid freeze/thaw cycles to maintain antibody integrity.

What is the host species and clonality of the anti-SALL4 antibody ZR276?

The anti-SALL4 antibody ZR276 is a rabbit monoclonal antibody with an IgG isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.