Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human spleen stained with anti-perforin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic granular staining of cytotoxic T cells

rabbit anti-Perforin monoclonal antibody (ZR270) 6330

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Perforin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Spleen
Visualization: Granular cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6330parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, monoclonal, Perforin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Perforin monoclonal antibody ZR270 6330

antibody
Database link: human P14222
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Spleen
Immunogen Recombinant human Perforin protein fragment (around aa 413-552)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens PRF1 Perforin-1
Protein names Perforin-1
Alternative names Cytolysin, Lymphocyte pore-forming protein
Gene names PRF1
Protein family Belongs to the complement C6/C7/C8/C9 family
Function Pore-forming protein that plays a key role in granzyme-mediated programmed cell death, and in defense against virus-infected or neoplastic cells (PubMed:20889983, PubMed:21037563, PubMed:24558045, PubMed:9058810, PubMed:9164947). Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease (PubMed:9058810). Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores (PubMed:20889983, PubMed:21037563). Promotes cytolysis and apoptosis of target cells by mediating the passage and uptake of cytotoxic granzymes (PubMed:20038786, PubMed:20225066, PubMed:24558045, PubMed:32299851). Facilitates the delivery of cationic cargo protein, while anionic or neural proteins are not delivered efficiently (PubMed:24558045). Perforin pores allow the release of mature caspase-7 (CASP7) into the extracellular milieu (By similarity)
Subcellular location Cytolytic granule, Secreted, Cell membrane, Endosome lumen
Structure Monomer, as soluble protein (PubMed:20889983, PubMed:21037563). Homooligomer; homooligomerizes to form a pore-forming ring (PubMed:20889983, PubMed:21037563)
Post-translational modification N-glycosylated
Involvement in disease Hemophagocytic lymphohistiocytosis, familial, 2 A rare disorder characterized by immune dysregulation with hypercytokinemia, defective function of natural killer cell, and massive infiltration of several organs by activated lymphocytes and macrophages. The clinical features of the disease include fever, hepatosplenomegaly, cytopenia, and less frequently neurological abnormalities ranging from irritability and hypotonia to seizures, cranial nerve deficits and ataxia.
Keywords Calcium, Cell membrane, Cytolysis, Disease variant, Disulfide bond, EGF-like domain, Endosome, Familial hemophagocytic lymphohistiocytosis, Glycoprotein, Lysosome, Membrane, Metal-binding, Proteomics identification, Reference proteome, Secreted, Signal, Transmembrane, Transmembrane beta strand
Sequence MAARLLLLGILLLLLPLPVPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD AARSIRNDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYS FHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALR TCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERH SEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREAL RRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT FIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRL QVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQ MLLGEPPGNRSGAVW
UniProt accession: P14222

Data

Formalin-fixed, paraffin-embedded human spleen stained with anti-perforin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic granular staining of cytotoxic T cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Perforin monoclonal antibody (ZR270) specifically react with?

This antibody specifically reacts with human Perforin, making it suitable for studies involving human tissue samples.

What are the recommended storage conditions for maintaining the stability of this antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze-thaw cycles to maintain antibody integrity.

Which applications is the rabbit anti-Perforin monoclonal antibody (ZR270) validated for, and what is the suggested dilution for use?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. The recommended dilution range for the concentrated antibody is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.