Immunohistochemistry (IHC) : Human epithelioid sarcoma stained with anti-INI-1 antibody using peroxidase-conjugate and DAB. Note the absence of nuclear staining of tumor cells, whereas the background cells are positive.

rabbit anti-INI-1 monoclonal antibody (ZR282) 6230

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to INI-1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Epithelioid sarcoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6230parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, INI-1, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-INI-1 monoclonal antibody ZR282 6230

antibody
Database link: human Q12824
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Epithelioid sarcoma
Immunogen Full-length human BAF47 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens SMARCB1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Protein names SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Alternative names BRG1-associated factor 47, Integrase interactor 1 protein, SNF5 homolog
Gene names SMARCB1
Protein family Belongs to the SNF5 family
Function Core component of the BAF (hSWI/SNF) complex. This ATP-dependent chromatin-remodeling complex plays important roles in cell proliferation and differentiation, in cellular antiviral activities and inhibition of tumor formation. The BAF complex is able to create a stable, altered form of chromatin that constrains fewer negative supercoils than normal. This change in supercoiling would be due to the conversion of up to one-half of the nucleosomes on polynucleosomal arrays into asymmetric structures, termed altosomes, each composed of 2 histones octamers. Stimulates in vitro the remodeling activity of SMARCA4/BRG1/BAF190A. Involved in activation of CSF1 promoter. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity). Plays a key role in cell-cycle control and causes cell cycle arrest in G0/G1
Subcellular location Nucleus
Structure (Microbial infection) Binds tightly to the human immunodeficiency virus-type 1 (HIV-1) integrase in vitro and stimulates its DNA-joining activity. Interacts with human papillomavirus 18 E1 protein to stimulate its viral replication (PubMed:10365963). Interacts with Epstein-Barr virus protein EBNA-2 (PubMed:8709224)
Involvement in disease Rhabdoid tumor predisposition syndrome 1 A familial cancer syndrome predisposing to renal or extrarenal malignant rhabdoid tumors and to a variety of tumors of the central nervous system, including choroid plexus carcinoma, medulloblastoma, and central primitive neuroectodermal tumors. Rhabdoid tumors are the most aggressive and lethal malignancies occurring in early childhood. Schwannomatosis 1 An autosomal dominant tumor predisposition syndrome characterized by the development of multiple benign nerve sheath tumors called schwannomas on cranial, spinal, and peripheral nerves, without involvement of the vestibular nerve. Affected individuals may also have multiple meningiomas. Coffin-Siris syndrome 3 A form of Coffin-Siris syndrome, a congenital multiple malformation syndrome with broad phenotypic and genetic variability. Cardinal features are intellectual disability, coarse facial features, hypertrichosis, and hypoplastic or absent fifth digit nails or phalanges. Additional features include malformations of the cardiac, gastrointestinal, genitourinary, and/or central nervous systems. Sucking/feeding difficulties, poor growth, ophthalmologic abnormalities, hearing impairment, and spinal anomalies are common findings. Both autosomal dominant and autosomal recessive inheritance patterns have been reported.
Keywords 3D-structure, Activator, Alternative splicing, Cell cycle, Chromatin regulator, Disease variant, DNA-binding, Host-virus interaction, Hypotrichosis, Intellectual disability, Isopeptide bond, Neurogenesis, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Transcription, Transcription regulation, Tumor suppressor, Ubl conjugation
Sequence MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEER KKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYL REQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA SQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASA IRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSE LGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAE MEKKIRDQDRNTRRMRRLANTAPAW
UniProt accession: Q12824

Data

Human epithelioid sarcoma stained with anti-INI-1 antibody using peroxidase-conjugate and DAB. Note the absence of nuclear staining of tumor cells, whereas the background cells are positive.

FAQ & Publications

Frequently Asked Questions

What species reactivity does the rabbit anti-INI-1 monoclonal antibody (ZR282) exhibit?

This antibody is reactive with human tissues only.

Which applications is the rabbit anti-INI-1 monoclonal antibody (ZR282) validated for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this antibody?

Store the antibody at 2-8°C for short-term use and at -20°C for long-term storage, avoiding freeze/thaw cycles.

What is the host species and clonality of the anti-INI-1 antibody ZR282?

The antibody is a rabbit monoclonal antibody.

What positive control is recommended when using this antibody in IHC assays?

Epithelioid sarcoma tissue is recommended as a positive control for immunohistochemistry.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.