Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human Ewing’s sarcoma stained with anti-FLI-1 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells and vascular endothelial cells

rabbit anti-FLI-1 monoclonal antibody (ZR217) 6183

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to FLI-1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Ewing’s sarcoma/PNET, lymphoblastic lymphoma, lymphocytes, endothelial cells, angiosarcoma, Kaposi’s sarcoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6183parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, FLI-1, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-FLI-1 monoclonal antibody ZR217 6183

antibody
Database link: human Q01543
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Ewing's sarcoma/PNET, lymphoblastic lymphoma, lymphocytes, endothelial cells, angiosarcoma, Kaposi's sarcoma
Immunogen Recombinant full-length human FLI1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens FLI1 Friend leukemia integration 1 transcription factor
Protein names Friend leukemia integration 1 transcription factor
Alternative names Proto-oncogene Fli-1, Transcription factor ERGB
Gene names FLI1
Protein family Belongs to the ETS family
Function Sequence-specific transcriptional activator (PubMed:24100448, PubMed:26316623, PubMed:28255014). Recognizes the DNA sequence 5'-C[CA]GGAAGT-3'
Subcellular location Nucleus
Structure Can form homodimers or heterodimers with ETV6/TEL1
Involvement in disease Ewing sarcoma A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. Bleeding disorder, platelet-type, 21 A disorder characterized by increased bleeding tendency due to platelet dysfunction. Clinical features include epistaxis, hematomas, bleeding after tooth extraction, and menorrhagia. BDPLT21 patients may have mild to moderate thrombocytopenia.
Keywords 3D-structure, Activator, Alternative splicing, Chromosomal rearrangement, Disease variant, DNA-binding, Nucleus, Phosphoprotein, Proteomics identification, Proto-oncogene, Reference proteome, Transcription, Transcription regulation
Sequence MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ PVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTN ERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATT LYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNK SPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF DFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY
UniProt accession: Q01543

Data

Formalin-fixed, paraffin-embedded human Ewing'ss sarcoma stained with anti-FLI-1 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells and vascular endothelial cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-FLI-1 monoclonal antibody (ZR217) specifically react with?

This antibody specifically reacts with human tissues.

Which applications is the rabbit anti-FLI-1 monoclonal antibody (ZR217) validated for?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this antibody?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, store it at -20°C. Avoid repeated freeze/thaw cycles.

What immunogen was used to produce the rabbit anti-FLI-1 monoclonal antibody (ZR217)?

The antibody was raised against recombinant full-length human FLI1 protein.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.