Immunohistochemistry (IHC) : Human ovarian carcinoma stained with anti-Keratin 7 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

rabbit anti-Cytokeratin 7 monoclonal antibody (ZR428) 6424

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Cytokeratin 7
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Ovarian carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6424parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin 7, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Cytokeratin 7 monoclonal antibody ZR428 6424

antibody
Database link: human P08729
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Ovarian carcinoma
Immunogen OTN II ovarian carcinoma cell line
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens KRT7 Keratin, type II cytoskeletal 7
Protein names Keratin, type II cytoskeletal 7
Alternative names Cytokeratin-7, Keratin-7, Sarcolectin, Type-II keratin Kb7
Gene names KRT7
Protein family Belongs to the intermediate filament family
Function Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7)
Subcellular location Cytoplasm
Structure (Microbial infection) Interacts with human papillomavirus 16/HPV16 protein E7
Post-translational modification Arg-20 is dimethylated, probably to asymmetric dimethylarginine
Keywords 3D-structure, Acetylation, Coiled coil, Cytoplasm, Direct protein sequencing, Glycoprotein, Host-virus interaction, Intermediate filament, Isopeptide bond, Keratin, Methylation, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVG AGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLE TKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKY EDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQI SDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDD LRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAA LQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG GSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD
UniProt accession: P08729

Data

Human ovarian carcinoma stained with anti-Keratin 7 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Cytokeratin 7 monoclonal antibody (ZR428) specifically react with?

This antibody specifically reacts with human Cytokeratin 7.

For which application is the rabbit anti-Cytokeratin 7 monoclonal antibody (ZR428) validated?

It is validated for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this antibody to maintain its stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, keep it at -20°C while avoiding freeze/thaw cycles.

What is the host species and clonality of the anti-Cytokeratin 7 antibody ZR428?

The antibody is a rabbit monoclonal antibody with an IgG isotype.

What are the available sizes and formats for the rabbit anti-Cytokeratin 7 monoclonal antibody (ZR428)?

The antibody is available as concentrated formulations in 0.1 mL, 0.5 mL, and 1.0 mL volumes, as well as a 7 mL prediluted format.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.