Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human prostate carcinoma stained with anti-cytokeratin 5/6 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of basal cells in the normal prostate (left), whereas carcinoma glands (right) are negative.

rabbit anti-Cytokeratin 5/6 monoclonal antibody (ZR412) 6148

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Cytokeratin 5/6
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Prostate
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6148parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin 5/6, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Cytokeratin 5/6 monoclonal antibody ZR412 6148

antibody
Database link: human P01732 human P01731
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Prostate
Immunogen Recombinant fragments of human Cytokeratin 5 (KRT5) and Cytokeratin 6 proteins
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens KRT6A Keratin, type II cytoskeletal 6A
Protein names Keratin, type II cytoskeletal 6A
Alternative names Cytokeratin-6A, Cytokeratin-6D, Keratin-6A, Type-II keratin Kb6
Gene names KRT6A
Protein family Belongs to the intermediate filament family
Function Structural component of intermediate filaments in epithelial keratinocytes. Forms heteropolymers with the type I keratins KRT16 and KRT17, assembling into keratin intermediate filament networks that contributes to the structural integrity and stress resilience of stratified epithelia, particularly in epidermis, nail bed and oral mucosa (PubMed:11886499, PubMed:17719747, PubMed:7545493). Rapidly induced in wound-edge keratinocytes and participates in cytoskeletal reorganization during re-epithelialization (By similarity). Negatively regulates collective keratinocyte migration by stabilizing non-muscle myosin MYH9 and desmoplakin, thereby altering cell-cell and cell-matrix adhesion and reducing the speed and directionality of epithelial sheet movement during wound repair (By similarity). Also limits epithelial migration by inhibiting SRC activity during wound repair (By similarity). Required for normal palmoplantar, nail unit and oral mucosa integrity (PubMed:11886499, PubMed:17719747, PubMed:7545493)
Subcellular location Cytoplasm
Structure Heterodimers composed of one type I and one type II keratins; forms parallel coiled-coil heterodimers (By similarity). Heterodimers associate in an antiparallel manner to form heterotetramers, which further assemble into higher-order keratin intermediate filaments (By similarity). Associates with KRT16 and/or KRT17 (By similarity). Interacts with TCHP (PubMed:15731013). Interacts with IIA/MYH2; the interaction stabilizes MYH2 (By similarity)
Involvement in disease Pachyonychia congenita 3 An autosomal dominant genodermatosis characterized by hypertrophic nail dystrophy, painful and highly debilitating plantar keratoderma, oral leukokeratosis, and a variety of epidermal cysts.
Keywords 3D-structure, Acetylation, Allergen, Coiled coil, Cytoplasm, Direct protein sequencing, Disease variant, Ectodermal dysplasia, Intermediate filament, Keratin, Palmoplantar keratoderma, Proteomics identification, Reference proteome
Sequence MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRS LYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAG GFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDK VRFLEQQNKVLETKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELR GMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRA LYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKY EELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEG VGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLS SVGGGSSTIKYTTTSSSSRKSYKH
UniProt accession: P02538

Data

Formalin-fixed, paraffin-embedded human prostate carcinoma stained with anti-cytokeratin 5/6 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of basal cells in the normal prostate (left), whereas carcinoma glands (right) are negative.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution range for using the rabbit anti-Cytokeratin 5/6 monoclonal antibody (ZR412) in immunohistochemistry?

For immunohistochemistry applications, the concentrated rabbit anti-Cytokeratin 5/6 monoclonal antibody (ZR412) is recommended to be diluted between 1:100 and 1:200.

How should the rabbit anti-Cytokeratin 5/6 monoclonal antibody (ZR412) be stored to maintain its stability?

The antibody should be stored at 2-8°C for short term storage. For longer term storage, it is recommended to keep the antibody at -20°C and to avoid repeated freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.