Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded colon carcinoma stained with anti-TROP2 antibody using peroxidase-conjugate and DAB chromogen. Note the cell surface staining of tumor cells

rabbit anti-TROP2 monoclonal antibody (ZR388) 6393

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to TROP2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Colon or breast carcinoma
Visualization: Cell surface
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6393parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, General & Epithelial Markers, TROP2

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-TROP2 monoclonal antibody ZR388 6393

antibody
Database link: human P09758
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Colon or breast carcinoma
Immunogen Recombinant fragment of human TACSTD2 protein (around aa 31-274)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens TACSTD2 Tumor-associated calcium signal transducer 2
Protein names Tumor-associated calcium signal transducer 2
Alternative names Cell surface glycoprotein Trop-2, Membrane component chromosome 1 surface marker 1, Pancreatic carcinoma marker protein GA733-1
Gene names TACSTD2
Protein family Belongs to the EPCAM family
Function May function as a growth factor receptor
Subcellular location Membrane
Post-translational modification The N-terminus is blocked
Involvement in disease Corneal dystrophy, gelatinous drop-like A form of lattice corneal dystrophy, a class of inherited stromal amyloidoses characterized by pathognomonic branching lattice figures in the cornea. GDLD is an autosomal recessive disorder characterized by severe corneal amyloidosis leading to blindness. Clinical manifestations, which appear in the first decade of life, include blurred vision, photophobia, and foreign-body sensation. By the third decade, raised, yellowish-gray, gelatinous masses severely impair visual acuity.
Keywords 3D-structure, Amyloid, Amyloidosis, Corneal dystrophy, Disulfide bond, Glycoprotein, Membrane, Proteomics identification, Reference proteome, Sensory transduction, Signal, Transmembrane, Transmembrane helix, Tumor antigen, Vision
Sequence MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGS GMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCN QTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLF RERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRG GLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNR RKSGKYKKVEIKELGELRKEPSL
UniProt accession: P09758

Data

Formalin-fixed, paraffin-embedded colon carcinoma stained with anti-TROP2 antibody using peroxidase-conjugate and DAB chromogen. Note the cell surface staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-TROP2 monoclonal antibody (ZR388) specifically react with?

The rabbit anti-TROP2 monoclonal antibody (ZR388) specifically reacts with human tissues.

Which applications is this anti-TROP2 antibody validated for?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the rabbit anti-TROP2 monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C; for long-term storage, store at -20°C and avoid repeated freeze/thaw cycles.

What is the recommended dilution range for using the concentrated form of this anti-TROP2 antibody in IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.