Immunohistochemistry (IHC) : Human tonsil stained with anti-PCNA antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of lymphoid cells.

mouse anti-PCNA monoclonal antibody (PC10) 6325

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to PCNA
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Tonsil, lymph node or small intestine
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6325parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, General & Epithelial Markers, PCNA

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-PCNA monoclonal antibody PC10 6325

antibody
Database link: human P12004
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil, lymph node or small intestine
Immunogen Recombinant rat PCNA protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens PCNA DNA sliding clamp PCNA
Protein names DNA sliding clamp PCNA
Alternative names Cyclin, Proliferating cell nuclear antigen
Gene names PCNA
Protein family Belongs to the PCNA family
Function Confers DNA tethering and processivity to DNA polymerases and other proteins (PubMed:24695737, PubMed:24939902, PubMed:35585232). Auxiliary protein of DNA polymerase delta and epsilon, is involved in the control of DNA replication by increasing the polymerases' processivity during elongation of the leading strand (PubMed:35585232). Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways (PubMed:24939902). Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion (PubMed:24695737)
Subcellular location Nucleus
Structure (Microbial infection) Interacts with herpes virus 8 protein LANA1
Post-translational modification Phosphorylated. Phosphorylation at Tyr-211 by EGFR stabilizes chromatin-associated PCNA Acetylated by CREBBP and p300/EP300; preferentially acetylated by CREBBP on Lys-80, Lys-13 and Lys-14 and on Lys-77 by p300/EP300 upon loading on chromatin in response to UV irradiation (PubMed:19419956, PubMed:24939902). Lysine acetylation disrupts association with chromatin, hence promoting PCNA ubiquitination and proteasomal degradation in response to UV damage in a CREBBP- and EP300-dependent manner (PubMed:24939902). Acetylation disrupts interaction with NUDT15 and promotes degradation (PubMed:19419956) Ubiquitinated (PubMed:20227374, PubMed:24939902). Following DNA damage, can be either monoubiquitinated to stimulate direct bypass of DNA lesions by specialized DNA polymerases or polyubiquitinated to promote recombination-dependent DNA synthesis across DNA lesions by template switching mechanisms. Following induction of replication stress, monoubiquitinated by the UBE2B-RAD18 complex on Lys-164, leading to recruit translesion (TLS) polymerases, which are able to synthesize across DNA lesions in a potentially error-prone manner. An error-free pathway also exists and requires non-canonical polyubiquitination on Lys-164 through 'Lys-63' linkage of ubiquitin moieties by the E2 complex UBE2N-UBE2V2 and the E3 ligases, HLTF, RNF8 and SHPRH. This error-free pathway, also known as template switching, employs recombination mechanisms to synthesize across the lesion, using as a template the undamaged, newly synthesized strand of the sister chromatid. Monoubiquitination at Lys-164 also takes place in undamaged proliferating cells, and is mediated by the DCX(DTL) complex, leading to enhance PCNA-dependent translesion DNA synthesis. Sumoylated during S phase Methylated on glutamate residues by DCPH1/C6orf211
Involvement in disease Ataxia-telangiectasia-like disorder 2 A neurodegenerative disorder due to defects in DNA excision repair. ATLD2 is characterized by developmental delay, ataxia, sensorineural hearing loss, short stature, cutaneous and ocular telangiectasia, and photosensitivity.
Keywords 3D-structure, Acetylation, Deafness, Direct protein sequencing, Disease variant, Disulfide bond, DNA damage, DNA repair, DNA replication, DNA-binding, Dwarfism, Host-virus interaction, Isopeptide bond, Methylation, Neurodegeneration, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Ubl conjugation
Sequence MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK IADMGHLKYYLAPKIEDEEGS
UniProt accession: P12004

Data

Human tonsil stained with anti-PCNA antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of lymphoid cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-PCNA monoclonal antibody (PC10) react with?

This antibody reacts specifically with human PCNA protein.

Which applications is the mouse anti-PCNA monoclonal antibody (PC10) validated for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for this antibody to maintain stability?

Store the antibody at 2-8°C for short-term use and at -20°C for long-term storage, avoiding repeated freeze-thaw cycles.

What forms and sizes are available for the mouse anti-PCNA monoclonal antibody (PC10)?

The antibody is available as concentrated solutions in 0.1 mL, 0.5 mL, and 1.0 mL volumes, as well as a 7 mL prediluted format.

What is the host species and isotype of this anti-PCNA antibody?

The antibody is a mouse monoclonal antibody of the IgG2a isotype.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.