Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human prostate carcinoma stained with anti-cytokeratin 5/6 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of basal cells in the normal prostate (left), whereas carcinoma glands (right) are negative.

rabbit anti-Cytokeratin 5/6 monoclonal antibody (ZR412) 6148

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Cytokeratin 5/6
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Prostate
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6148parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin 5/6, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Cytokeratin 5/6 monoclonal antibody ZR412 6148

antibody
Database link: human P01732 human P01731
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Prostate
Immunogen Recombinant fragments of human Cytokeratin 5 (KRT5) and Cytokeratin 6 proteins
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Protein names T-cell surface glycoprotein CD8 alpha chain (T-lymphocyte differentiation antigen T8/Leu-2) (CD antigen CD8a)
Gene names CD8A,CD8A MAL
Mass 25729Da
Catalytic activity CD8A MAL
Pathway 9606
Subellular location CD8A MAL
Domain MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Target Relevance information above includes information from UniProt accession: P01732
The UniProt Consortium

Data

Formalin-fixed, paraffin-embedded human prostate carcinoma stained with anti-cytokeratin 5/6 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of basal cells in the normal prostate (left), whereas carcinoma glands (right) are negative.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution range for using the rabbit anti-Cytokeratin 5/6 monoclonal antibody (ZR412) in immunohistochemistry?

For immunohistochemistry applications, the concentrated rabbit anti-Cytokeratin 5/6 monoclonal antibody (ZR412) is recommended to be diluted between 1:100 and 1:200.

How should the rabbit anti-Cytokeratin 5/6 monoclonal antibody (ZR412) be stored to maintain its stability?

The antibody should be stored at 2-8°C for short term storage. For longer term storage, it is recommended to keep the antibody at -20°C and to avoid repeated freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.