Skip to content

rabbit anti-CDK4 monoclonal antibody (ZR394) 6118

Price range: $160.00 through $528.00

Antibody summary

  • Rabbit monoclonal to CDK4
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG
  • Control: Urothelial carcinoma, well-differentiated liposarcoma
  • Visualization: Nucleus and cytoplasm
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
SKU: 6118parent Categories: , Tags: , ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-CDK4 monoclonal antibody ZR394 6118

antibody
Database link:
human P11802
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Urothelial carcinoma, well-differentiated liposarcoma
Immunogen
Recombinant fragment corresponding to N-terminal of human CDK4 protein
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens CDK4
Cyclin-dependent kinase 4
Protein names
Cyclin-dependent kinase 4
Alternative names
Cell division protein kinase 4, PSK-J3
Gene names
CDK4
Protein family
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily
Function
Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex
Catalytic activity
L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+)
L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+)
Subcellular location
Cytoplasm, Nucleus, Nucleus membrane
Structure
Component of the D-CDK4 complex, composed of CDK4 and some D-type G1 cyclin (CCND1, CCND2 or CCND3). Interacts directly in the complex with CCND1, CCND2 or CCND3. Interacts with SEI1 and ZNF655. Forms a ternary complex, cyclin D-CDK4-CDKN1B, involved in modulating CDK4 enzymatic activity. Interacts directly with CDKN1B (phosphorylated on 'Tyr-88' and 'Tyr-89'); the interaction allows assembly of the cyclin D-CDK4 complex, Thr-172 phosphorylation, nuclear translocation and enhances the cyclin D-CDK4 complex activity. CDK4 activity is either inhibited or enhanced depending on stoichiometry of complex. The non-tyrosine-phosphorylated form of CDKN1B prevents T-loop phosphorylation of CDK4 producing inactive CDK4. Interacts (unphosphorylated form) with CDK2. Also forms ternary complexes with CDKN1A or CDKN2A. Interacts directly with CDKN1A (via its N-terminal); the interaction promotes the assembly of the cyclin D-CDK4 complex, its nuclear translocation and promotes the cyclin D-dependent enzyme activity of CDK4. Interacts with CCND1; the interaction is prevented with the binding of CCND1 to INSM1 during cell cycle progression. Probably forms a complex composed of chaperones HSP90 and HSP70, co-chaperones CDC37, PPP5C, TSC1 and client protein TSC2, CDK4, AKT, RAF1 and NR3C1; this complex does not contain co-chaperones STIP1/HOP and PTGES3/p23 (PubMed:29127155). Interacts with CEBPA (when phosphorylated) (PubMed:15107404). Interacts with FNIP1 and FNIP2 (PubMed:27353360)
Post-translational modification
Phosphorylation at Thr-172 is required for enzymatic activity. Phosphorylated, in vitro, at this site by CCNH-CDK7, but, in vivo, appears to be phosphorylated by a proline-directed kinase. In the cyclin D-CDK4-CDKN1B complex, this phosphorylation and consequent CDK4 enzyme activity, is dependent on the tyrosine phosphorylation state of CDKN1B. Thus, in proliferating cells, CDK4 within the complex is phosphorylated on Thr-172 in the T-loop. In resting cells, phosphorylation on Thr-172 is prevented by the non-tyrosine-phosphorylated form of CDKN1B
Involvement in disease
Melanoma, cutaneous malignant 3
A malignant neoplasm of melanocytes, arising de novo or from a pre-existing benign nevus, which occurs most often in the skin but may also involve other sites.

Keywords
3D-structure, Acetylation, Alternative splicing, ATP-binding, Cell cycle, Cell division, Cytoplasm, Disease variant, Kinase, Membrane, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Transferase
Sequence
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG NPE
UniProt accession: P11802

Data

Formalin-fixed, paraffin-embedded human liposarcoma stained with anti-CDK4 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear/cytoplasmic staining of tumor cells.
Formalin-fixed, paraffin-embedded human liposarcoma stained with anti-CDK4 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear/cytoplasmic staining of tumor cells.

FAQ & Publications

Frequently Asked Questions
What applications is the rabbit anti-CDK4 monoclonal antibody (ZR394) suitable for?
This antibody is suitable for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.
How should the rabbit anti-CDK4 monoclonal antibody be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For longer term storage, it should be kept at -20°C and freeze/thaw cycles should be avoided.
What species does the rabbit anti-CDK4 monoclonal antibody (ZR394) react with?
This antibody specifically reacts with human CDK4 protein.
What is the recommended dilution for using the concentrated form of this antibody in IHC?
The concentrated antibody is recommended to be diluted between 1:100 and 1:200 for immunohistochemistry applications.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.