rabbit anti-Calreticulin monoclonal antibody 9015

$409.00

Antibody summary

Rabbit monoclonal to Calreticulin
Suitable for: WB, ICC/IF, IHC
Reacts with: human, mouse, rat
Isotype: IgG
100 µg

SKU: 9015 Categories: antibody, cell marker Tag: Calreticulin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	rabbit
isotype	IgG
clonality	monoclonal
concentration	1 mg/mL
applications	ICC/IF, IHC, WB
available sizes	100 µg

rabbit anti-Calreticulin monoclonal antibody 9015

antibody
Database link: human P27797 mouse P14211 rat P18418
Tested applications WB,IHC,IHC,ICC/IF
Recommended dilutions WB: 1:1000-1:2000 IF/ICC and IHC: 1:1000
Immunogen Synthetic peptides VESGSLEDDWDFLPPKKI corresponding to amino acids 191-208 of human calreticulin, including the LC3 interacting region or LIR.
Size and concentration 100µg and 1 mg/mL
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Storage buffer PBS, 50% glycerol, 0.04% NaN₃
Purity affinity purified
Clonality polyclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal IgG - Isotype Control

target relevance
Homo sapiens CALR Calreticulin
Protein names Calreticulin
Alternative names CRP55, Calregulin, Endoplasmic reticulum resident protein 60, HACBP, grp60
Gene names CALR
Protein family Belongs to the calreticulin family
Function Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER (PubMed:7876246). Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export (PubMed:11149926). Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis (By similarity). Present in the cortical granules of non-activated oocytes, is exocytosed during the cortical reaction in response to oocyte activation and might participate in the block to polyspermy (By similarity)
Subcellular location Endoplasmic reticulum lumen, Cytoplasm, cytosol, Secreted, extracellular space, extracellular matrix, Cell surface, Sarcoplasmic reticulum lumen, Cytoplasmic vesicle, secretory vesicle, Cortical granule, Cytolytic granule
Structure Monomer. Component of an EIF2 complex at least composed of CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1 and HSPA5. Interacts with PDIA3/ERp57 and SPACA9 (By similarity). Interacts with TRIM21 (PubMed:8666824). Interacts with NR3C1 (PubMed:11149926). Interacts with PPIB (PubMed:20801878). Interacts (via P-domain) with PDIA5 (PubMed:23614004). Interacts with GABARAP (PubMed:19154346). Interacts with HLA-E-B2M and HLA-G-B2M complexes (PubMed:9427624, PubMed:9640257). Interacts with HLA-F (PubMed:10605026). Interacts with CLCC1 (PubMed:30157172)
Keywords 3D-structure, Acetylation, Calcium, Chaperone, Cytoplasm, Cytoplasmic vesicle, Direct protein sequencing, Disulfide bond, Endoplasmic reticulum, Extracellular matrix, Glycoprotein, Hydroxylation, Lectin, Lysosome, Metal-binding, Proteomics identification, Reference proteome, Repeat, Sarcoplasmic reticulum, Secreted, Signal, Zinc
Sequence MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
UniProt accession: P27797

Data

benchmarkantibodies.com/wp-content/uploads/2024/03/9015_1.jpg

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Calreticulin monoclonal antibody 9015 react with and what applications is it validated for?

This antibody reacts with human, mouse, and rat calreticulin and is validated for use in Western blot (WB), immunocytochemistry/immunofluorescence (ICC/IF), and immunohistochemistry (IHC) applications.

How should the rabbit anti-Calreticulin monoclonal antibody 9015 be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.