Immunohistochemistry (IHC) : Human normal breast tissue stained with anti-Calponin-1 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of myoepithelial cells.

rabbit anti-Calponin-1 monoclonal antibody (ZR297) 6050

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Calponin-1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Normal breast tissue
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6050parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Calponin-1, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Calponin-1 monoclonal antibody ZR297 6050

antibody
Database link: human P51911
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Normal breast tissue
Immunogen Recombinant human full-length CNN1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CNN1 Calponin-1
Protein names Calponin-1
Alternative names Basic calponin, Calponin H1, smooth muscle
Gene names CNN1
Protein family Belongs to the calponin family
Function Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity (By similarity)
Structure Part of cGMP kinase signaling complex at least composed of ACTA2/alpha-actin, CNN1/calponin H1, PLN/phospholamban, PRKG1 and ITPR1
Keywords 3D-structure, Actin-binding, Alternative splicing, Calmodulin-binding, Phosphoprotein, Proteomics identification, Reference proteome, Repeat
Sequence MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL CEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV QSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMT AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA
UniProt accession: P51911

Data

Human normal breast tissue stained with anti-Calponin-1 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of myoepithelial cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Calponin-1 monoclonal antibody (ZR297) specifically react with?

This antibody specifically reacts with human tissues.

What are the recommended storage conditions for the rabbit anti-Calponin-1 monoclonal antibody to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, and freeze/thaw cycles should be avoided.

Which applications is the rabbit anti-Calponin-1 monoclonal antibody validated for, and what is the suggested dilution for immunohistochemistry?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. The recommended dilution for the concentrated antibody is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.