Immunohistochemistry (IHC) : Human breast ductal carcinoma in situ stained with anti-Calponin-1 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of myoepithelial cells.

mouse anti-Calponin-1 monoclonal antibody (ZM21) 6049

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Calponin-1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Normal breast tissue
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6049parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Calponin-1, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Calponin-1 monoclonal antibody ZM21 6049

antibody
Database link: human P51911
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Normal breast tissue
Immunogen Recombinant human CNN1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens CNN1 Calponin-1
Protein names Calponin-1
Alternative names Basic calponin, Calponin H1, smooth muscle
Gene names CNN1
Protein family Belongs to the calponin family
Function Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity (By similarity)
Structure Part of cGMP kinase signaling complex at least composed of ACTA2/alpha-actin, CNN1/calponin H1, PLN/phospholamban, PRKG1 and ITPR1
Keywords 3D-structure, Actin-binding, Alternative splicing, Calmodulin-binding, Phosphoprotein, Proteomics identification, Reference proteome, Repeat
Sequence MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL CEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV QSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMT AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA
UniProt accession: P51911

Data

Human breast ductal carcinoma in situ stained with anti-Calponin-1 antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of myoepithelial cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Calponin-1 monoclonal antibody (ZM21) specifically react with?

This antibody specifically reacts with human Calponin-1 protein.

What are the recommended storage conditions for maintaining the stability of this anti-Calponin-1 antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain stability.

Which applications and controls are recommended when using the mouse anti-Calponin-1 monoclonal antibody (ZM21) in immunohistochemistry?

The antibody is suitable for immunohistochemistry on formalin-fixed, paraffin-embedded tissues. Normal breast tissue is recommended as the positive control for validation of staining.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.