Immunohistochemistry (IHC) : Formalin-fixed and paraffin-embedded human chordoma stained with anti-brachyury antibody using peroxidase-conjugate and DAB chromogen. Note the absence of nuclear staining of tumor cells.

rabbit anti-Brachyury monoclonal antibody (ZR391) 6035

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Brachyury
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Chordoma
Visualization: Nucleus
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6035parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Brachyury, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Brachyury monoclonal antibody ZR391 6035

antibody
Database link: human O15178
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Chordoma
Immunogen Recombinant fragment (around aa 235-435) of human TBXT protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens TBXT T-box transcription factor T
Protein names T-box transcription factor T
Alternative names Brachyury protein, Protein T
Gene names TBXT
Function Involved in the transcriptional regulation of genes required for mesoderm formation and differentiation. Binds to a palindromic T site 5'-TTCACACCTAGGTGTGAA-3' DNA sequence and activates gene transcription when bound to such a site
Subcellular location Nucleus
Structure Monomer
Involvement in disease Neural tube defects Congenital malformations of the central nervous system and adjacent structures related to defective neural tube closure during the first trimester of pregnancy. Failure of neural tube closure can occur at any level of the embryonic axis. Common NTD forms include anencephaly, myelomeningocele and spina bifida, which result from the failure of fusion in the cranial and spinal region of the neural tube. NTDs have a multifactorial etiology encompassing both genetic and environmental components. Chordoma Rare, clinically malignant tumors derived from notochordal remnants. They occur along the length of the spinal axis, predominantly in the sphenooccipital, vertebral and sacrococcygeal regions. They are characterized by slow growth, local destruction of bone, extension into adjacent soft tissues and rarely, distant metastatic spread. Sacral agenesis with vertebral anomalies A disorder characterized by abnormalities of the spine, including sacral agenesis, abnormal ossification of all vertebral bodies, and a persistent notochordal canal during development.
Keywords 3D-structure, Activator, Alternative splicing, Developmental protein, Disease variant, DNA-binding, Nucleus, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MSSPGTESAGKSLQYRVDHLLSAVENELQAGSEKGDPTERELRVGLEESELWLRFKELTN EMIVTKNGRRMFPVLKVNVSGLDPNAMYSFLLDFVAADNHRWKYVNGEWVPGGKPEPQAP SCVYIHPDSPNFGAHWMKAPVSFSKVKLTNKLNGGGQIMLNSLHKYEPRIHIVRVGGPQR MITSHCFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERSDHKEMMEEPGDSQQPG YSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNS PTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQYPSLWSVSNGAVTP GSQAAAVSNGLGAQFFRGSPAHYTPLTHPVSAPSSSGSPLYEGAAAATDIVDSQYDAAAQ GRLIASWTPVSPPSM
UniProt accession: O15178

Data

Formalin-fixed and paraffin-embedded human chordoma stained with anti-brachyury antibody using peroxidase-conjugate and DAB chromogen. Note the absence of nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended application and dilution for the rabbit anti-Brachyury monoclonal antibody (ZR391)?

This antibody is suitable for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. The recommended dilution for the concentrated form is between 1:100 and 1:200.

How should the rabbit anti-Brachyury monoclonal antibody (ZR391) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

Which species does the rabbit anti-Brachyury monoclonal antibody (ZR391) specifically react with, and what is the host species of the antibody?

This antibody is reactive with human Brachyury protein. Despite being named 'rabbit anti-Brachyury,' the antibody host is actually mouse, and the isotype is IgG monoclonal.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.