Immunohistochemistry (IHC) : Human bladder urothelial carcinoma stained with anti-uroplakin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

mouse anti-Uroplakin monoclonal antibody (ZM204) 6400

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Uroplakin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b + IgG1
Control: Bladder or urothelial carcinoma
Visualization: Cytoplasmic and membranous
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6400parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Urinary Pathology, Uroplakin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b + IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Uroplakin monoclonal antibody ZM204 6400

antibody
Database link: human O14601
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Bladder or urothelial carcinoma
Immunogen Recombinant fragment (around aa 114-173) of human Uroplakin 1A (UPK1A) protein; recombinant fragment (around aa 109-229) of human Uroplakin 1B (UPK1B)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b + IgG1 - Isotype C

target relevance
Homo sapiens UPK1A Uroplakin-1a
Protein names Uroplakin-1a
Alternative names Tetraspanin-21, Uroplakin Ia
Gene names UPK1A
Protein family Belongs to the tetraspanin (TM4SF) family
Function Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane through AUM/cytoskeletal interactions (By similarity)
Subcellular location Membrane
Structure Homodimer; disulfide-linked. Interacts with uroplakin-2 (UPK2) (By similarity)
Keywords Alternative splicing, Disulfide bond, Glycoprotein, Membrane, Proteomics identification, Reference proteome, Transmembrane, Transmembrane helix
Sequence MASAAAAEAEKGSPVVVGLLVVGNIIILLSGLSLFAETIWVTADQYRVYPLMGVSGKDDV FAGAWIAIFCGFSFFMVASFGVGAALCRRRSMVLTYLVLMLIVYIFECASCITSYTHRDY MVSNPSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATP EVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAI LMWTLPVMLIAMYFYTML
UniProt accession: O00322

Data

Human bladder urothelial carcinoma stained with anti-uroplakin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended application and dilution for using the mouse anti-Uroplakin monoclonal antibody ZM204 6400?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues. The recommended dilution for the concentrated antibody is between 1:100 and 1:200.

How should the mouse anti-Uroplakin monoclonal antibody ZM204 6400 be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.