Immunohistochemistry (IHC) : Human tonsil stained with anti-tryptase antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of scattered mast cells.

mouse anti-Tryptase monoclonal antibody (ZM96) 6439

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Tryptase
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Mast cells containing tissue or tumors
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6439parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Hematopathology, Tryptase

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Tryptase monoclonal antibody ZM96 6439

antibody
Database link: human P20231
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Mast cells containing tissue or tumors
Immunogen Synthesized peptide corresponding to the C-terminus of human TRPS1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens TPSB2 Tryptase beta-2
Protein names Tryptase beta-2
Alternative names Tryptase II
Gene names TPSB2
Protein family Belongs to the peptidase S1 family. Tryptase subfamily
Function Tryptase is the major neutral protease present in mast cells and is secreted upon the coupled activation-degranulation response of this cell type. May play a role in innate immunity
Catalytic activity Preferential cleavage: Arg-\|-Xaa, Lys-\|-Xaa, but with more restricted specificity than trypsin.
Subcellular location Secreted
Structure Homotetramer. The active tetramer is converted to inactive monomers at neutral and acidic pH in the absence of heparin. Low concentrations of inactive monomers become active monomers at pH 6.0 in the presence of heparin. When the concentration of active monomers is higher, they convert to active monomers and then to active tetramers. These monomers are active and functionally distinct from the tetrameric enzyme. In contrast to the hidden active sites in the tetrameric form, the active site of the monomeric form is accessible for macromolecular proteins and inhibitors, e.g. fibrinogen which is a substrate for the monomeric but not for the tetrameric form. The monomeric form forms a complex with SERPINB6
Keywords 3D-structure, Disulfide bond, Glycoprotein, Hydrolase, Phosphoprotein, Protease, Proteomics identification, Reference proteome, Secreted, Serine protease, Signal, Zymogen
Sequence MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVRDRYWMHFCG GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
UniProt accession: P20231

Data

Human tonsil stained with anti-tryptase antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of scattered mast cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Tryptase monoclonal antibody (ZM96) react with?

This antibody specifically reacts with human tissues.

Which application is the mouse anti-Tryptase monoclonal antibody (ZM96) validated for?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-Tryptase monoclonal antibody (ZM96) be stored to maintain stability?

Store at 2-8°C for short term use and at -20°C for long-term storage, avoiding freeze/thaw cycles.

What is the recommended dilution for using the concentrated mouse anti-Tryptase monoclonal antibody (ZM96) in IHC?

The suggested dilution range for the concentrated antibody is 1:100 to 1:200.

What is the immunogen used to generate the mouse anti-Tryptase monoclonal antibody (ZM96)?

The immunogen is a synthesized peptide corresponding to the C-terminus of the human TRPS1 protein.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.