Immunohistochemistry (IHC) : Human thyroid carcinoma stained with anti-PAX-8 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear stain of tumor cells.

mouse anti-PAX-8 monoclonal antibody (ZM28) 6322

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to PAX-8
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Ovarian serous carcinoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6322parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, PAX-8, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-PAX-8 monoclonal antibody ZM28 6322

antibody
Database link: human Q06710
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Ovarian serous carcinoma
Immunogen Recombinant human PAX-8 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens PAX8 Paired box protein Pax-8
Protein names Paired box protein Pax-8
Gene names PAX8
Function Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells
Subcellular location Nucleus
Structure Interacts with WWTR1
Involvement in disease Hypothyroidism, congenital, non-goitrous, 2 A disease characterized by thyroid dysgenesis, the most frequent cause of congenital hypothyroidism, accounting for 85% of case. The thyroid gland can be completely absent (athyreosis), ectopically located and/or severely hypoplastic. Ectopic thyroid gland is the most frequent malformation, with thyroid tissue being found most often at the base of the tongue.
Keywords 3D-structure, Alternative splicing, Congenital hypothyroidism, Developmental protein, Differentiation, Disease variant, DNA-binding, Nucleus, Paired box, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY SINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPF ERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQAL LSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP NSSLLSSPYYYSSTSRPSAPPTTATAFDHL
UniProt accession: Q06710

Data

Human thyroid carcinoma stained with anti-PAX-8 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear stain of tumor cells.

FAQ & Publications

Frequently Asked Questions

What tissue types and species is the mouse anti-PAX-8 monoclonal antibody (ZM28) validated for use with?

This antibody is validated for immunohistochemistry on formalin-fixed, paraffin-embedded human tissues. It is reactive with human samples and has been tested using ovarian serous carcinoma as a positive control.

How should the mouse anti-PAX-8 monoclonal antibody (ZM28) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.