Immunohistochemistry (IHC) : Human prostate stained with anti-NKX3.1 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of glandular cells.

mouse anti-NKX3.1 monoclonal antibody (ZM95) 6291

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to NKX3.1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Prostate
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6291parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, NKX3.1, Urinary Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-NKX3.1 monoclonal antibody ZM95 6291

antibody
Database link: human Q99801
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Prostate
Immunogen Recombinant fragment (around aa 92-224) of human NKX3.1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens NKX3-1 Homeobox protein Nkx-3.1
Protein names Homeobox protein Nkx-3.1
Alternative names Homeobox protein NK-3 homolog A
Gene names NKX3-1
Protein family Belongs to the NK-3 homeobox family
Function Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Acts as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells
Subcellular location Nucleus
Structure Interacts with serum response factor (SRF) (By similarity). Interacts with SPDEF (PubMed:11809674). Interacts with WDR77 (PubMed:12972618). Interacts with TOPORS which polyubiquitinates NKX3-1 and induces its proteasomal degradation (PubMed:18077445). Interacts with FEM1B (By similarity)
Post-translational modification Ubiquitinated by TOPORS; monoubiquitinated at several residues and also polyubiquitinated on single residues
Keywords 3D-structure, Alternative splicing, DNA-binding, Homeobox, Nucleus, Proteomics identification, Reference proteome, Repressor, Transcription, Transcription regulation, Tumor suppressor, Ubl conjugation
Sequence MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEP EPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTP KQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTK RKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW
UniProt accession: Q99801

Data

Human prostate stained with anti-NKX3.1 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of glandular cells.

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-NKX3.1 monoclonal antibody (ZM95) recommended for?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples.

What are the storage conditions for the mouse anti-NKX3.1 monoclonal antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to maintain antibody integrity.

Which species does the mouse anti-NKX3.1 antibody specifically react with?

The antibody reacts specifically with human NKX3.1 protein.

What immunogen was used to generate the mouse anti-NKX3.1 monoclonal antibody (ZM95)?

The immunogen is a recombinant fragment of the human NKX3.1 protein, approximately amino acids 92 to 224.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.