Immunohistochemistry (IHC) : Human lung adenocarcinoma stained with anti-Napsin-A antibody using peroxidase-conjugate and DAB chromogen. Note cytopasmic staining carcinoma cells.

mouse anti-Napsin-A monoclonal antibody (ZM11) 6282

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Napsin-A
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Lung adenocarcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6282parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Lung/Mediastinum Pathology, Napsin-A

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Napsin-A monoclonal antibody ZM11 6282

antibody
Database link: human O14601
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Lung adenocarcinoma
Immunogen Recombinant fragment of human napsin protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens NAPSA Napsin-A
Protein names Napsin-A
Alternative names Aspartyl protease 4, Napsin-1, TA01/TA02
Gene names NAPSA
Protein family Belongs to the peptidase A1 family
Function May be involved in processing of pneumocyte surfactant precursors
Subcellular location Secreted
Keywords Aspartyl protease, Direct protein sequencing, Disulfide bond, Glycoprotein, Hydrolase, Protease, Proteomics identification, Reference proteome, Secreted, Signal, Zymogen
Sequence MSPPPLLQPLLLLLPLLNVEPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPS PGDKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHH RFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAF AHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDP AHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALH AAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQA LDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
UniProt accession: O96009

Data

Human lung adenocarcinoma stained with anti-Napsin-A antibody using peroxidase-conjugate and DAB chromogen. Note cytopasmic staining carcinoma cells.

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-Napsin-A monoclonal antibody (ZM11) validated for?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples.

How should the mouse anti-Napsin-A antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C, and for longer-term storage, freeze at -20°C while avoiding repeated freeze-thaw cycles.

Which species does the mouse anti-Napsin-A monoclonal antibody specifically react with?

The antibody is reactive with human Napsin-A protein.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.