Immunohistochemistry (IHC) : Human rhabdomyosarcoma stained with anti-Myogenin antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells.

mouse anti-Myogenin monoclonal antibody (ZM149) 6279

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Myogenin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Rhabdomyosarcoma or Wilm’s tumor
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6279parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Myogenin, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Myogenin monoclonal antibody ZM149 6279

antibody
Database link: human P15173
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Rhabdomyosarcoma or Wilm's tumor
Immunogen Human myogenin recombinant protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens MYOG Myogenin
Protein names Myogenin
Alternative names Class C basic helix-loop-helix protein 3, Myogenic factor 4
Gene names MYOG
Function Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation, cell cycle exit and muscle atrophy. Essential for the development of functional embryonic skeletal fiber muscle differentiation. However is dispensable for postnatal skeletal muscle growth; phosphorylation by CAMK2G inhibits its transcriptional activity in respons to muscle activity. Required for the recruitment of the FACT complex to muscle-specific promoter regions, thus promoting gene expression initiation. During terminal myoblast differentiation, plays a role as a strong activator of transcription at loci with an open chromatin structure previously initiated by MYOD1. Together with MYF5 and MYOD1, co-occupies muscle-specific gene promoter core regions during myogenesis. Also cooperates with myocyte-specific enhancer factor MEF2D and BRG1-dependent recruitment of SWI/SNF chromatin-remodeling enzymes to alter chromatin structure at myogenic late gene promoters. Facilitates cell cycle exit during terminal muscle differentiation through the up-regulation of miR-20a expression, which in turn represses genes involved in cell cycle progression. Binds to the E-box containing (E1) promoter region of the miR-20a gene. Also plays a role in preventing reversal of muscle cell differentiation. Contributes to the atrophy-related gene expression in adult denervated muscles. Induces fibroblasts to differentiate into myoblasts (By similarity)
Subcellular location Nucleus
Structure Homodimer and heterodimer with E12; heterodimerization enhances MYOG DNA-binding and transcriptional activities. Interacts with SMARCA4/BRG1/BAF190A. Interacts (via C-terminal region) with SSRP1 and SUPT16H; the interaction is indicative of an interaction with the FACT complex (By similarity). Interacts with CSRP3
Post-translational modification Phosphorylated by CAMK2G on threonine and serine amino acids in a muscle activity-dependent manner. Phosphorylation of Thr-87 impairs both DNA-binding and trans-activation functions in contracting muscles (By similarity)
Keywords Activator, Cell cycle, Developmental protein, Differentiation, DNA-binding, Myogenesis, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEH CPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFS ANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
UniProt accession: P15173

Data

Human rhabdomyosarcoma stained with anti-Myogenin antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution for the mouse anti-Myogenin monoclonal antibody (ZM149) when used in immunohistochemistry?

For immunohistochemistry applications, the concentrated mouse anti-Myogenin monoclonal antibody (ZM149) is recommended to be diluted between 1:100 and 1:200.

Which species does the mouse anti-Myogenin monoclonal antibody (ZM149) react with, and what tissues are suitable for its application?

This antibody specifically reacts with human tissues and is suitable for immunohistochemistry on formalin-fixed, paraffin-embedded human tissue samples.

How should the mouse anti-Myogenin monoclonal antibody (ZM149) be stored to maintain stability and avoid degradation?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, it should be stored at -20°C, and freeze-thaw cycles should be avoided to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.