Immunohistochemistry (IHC) : Human mantle cell lymphoma stained with anti-Cyclin D1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of lymphoma cells.

mouse anti-Cyclin D1 monoclonal antibody (ZM178) 6132

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Cyclin D1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Mantle cell lymphoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6132parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cyclin D1, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Cyclin D1 monoclonal antibody ZM178 6132

antibody
Database link: human P24385
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Mantle cell lymphoma
Immunogen Synthetic peptide corresponding to residues within aa 200-295 of Cyclin D1
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens CCND1 G1/S-specific cyclin-D1
Protein names G1/S-specific cyclin-D1
Alternative names B-cell lymphoma 1 protein, BCL-1 oncogene, PRAD1 oncogene
Gene names CCND1
Protein family Belongs to the cyclin family. Cyclin D subfamily
Function Regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition (PubMed:1827756, PubMed:1833066, PubMed:19412162, PubMed:33854235, PubMed:8114739, PubMed:8302605). Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase (PubMed:1827756, PubMed:1833066, PubMed:19412162, PubMed:8114739, PubMed:8302605). Hypophosphorylates RB1 in early G(1) phase (PubMed:1827756, PubMed:1833066, PubMed:19412162, PubMed:8114739, PubMed:8302605). Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals (PubMed:1827756, PubMed:1833066, PubMed:19412162, PubMed:8302605). Also a substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity (PubMed:15241418). Component of the ternary complex, cyclin D1/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (PubMed:9106657). Exhibits transcriptional corepressor activity with INSM1 on the NEUROD1 and INS promoters in a cell cycle-independent manner (PubMed:16569215, PubMed:18417529)
Subcellular location Nucleus, Cytoplasm, Nucleus membrane
Structure Interacts with either CDK4 or CDK6 protein kinase to form a serine/threonine kinase holoenzyme complex (PubMed:19237565, PubMed:8114739). The cyclin subunit imparts substrate specificity to the complex (PubMed:19237565, PubMed:20399237, PubMed:8302605, PubMed:9106657). Component of the ternary complex CCND1/CDK4/CDKN1B required for nuclear translocation and modulation of CDK4-mediated kinase activity (PubMed:9106657). Interacts directly with CDKN1B (By similarity). Can form similar complexes with either CDKN1A or CDKN2A (By similarity). Interacts with UHRF2; the interaction ubiquitinates CCND1 and appears to occur independently of phosphorylation (PubMed:21952639). Interacts with USP2 (PubMed:19917254). Interacts (via cyclin N-terminal domain) with INSM1 (via N-terminal region); the interaction competes with the binding of CCND1 to CDK4 during cell cycle progression and inhibits CDK4 activity (PubMed:16569215, PubMed:18417529, PubMed:19124461). Interacts with CDK4; the interaction is prevented with the binding of CCND1 to INSM1 during cell cycle progression (PubMed:19124461). Interacts with FBXO32; this interaction mediates CCND1 stabilization via 'Lys-27'-linked polyubiquitination (PubMed:40307251)
Post-translational modification Phosphorylation at Thr-286 by MAP kinases is required for ubiquitination and degradation by the DCX(AMBRA1) complex (PubMed:10766840, PubMed:17205132, PubMed:33854232, PubMed:33854235, PubMed:33854239). It also plays an essential role for recognition by the FBXO31 component of SCF (SKP1-cullin-F-box) protein ligase complex following DNA damage (PubMed:19412162) Ubiquitinated at Lys-269 by the DCX(AMBRA1) complex during the transition from G1 to S cell phase, leading to its degradation: ubiquitination is dependent on Thr-286 phosphorylation (PubMed:33854232, PubMed:33854235, PubMed:33854239). The DCX(AMBRA1) complex represents the major regulator of CCND1 stability during the G1/S transition (PubMed:33854232, PubMed:33854235, PubMed:33854239). Also ubiquitinated by the SCF(FBXO4) and Cul7-RING(FBXW8) ubiquitin-protein ligase complexes (PubMed:17205132). Following DNA damage it is ubiquitinated by the SCF(FBXO31) protein ligase complex (PubMed:19412162, PubMed:29279382). SCF(FBXO31) ubiquitination is dependent on Thr-286 phosphorylation (PubMed:10766840, PubMed:19412162, PubMed:29279382). Ubiquitinated also by UHRF2 apparently in a phosphorylation-independent manner (PubMed:21952639). Ubiquitination leads to its degradation and G1 arrest. Deubiquitinated by USP2; leading to its stabilization (PubMed:19917254). Ubiquitinated by FBXO32 at Lys-58 via 'Lys27'-linked polyubiquitination; leading to its stabilization (PubMed:40307251)
Involvement in disease Multiple myeloma A malignant tumor of plasma cells usually arising in the bone marrow and characterized by diffuse involvement of the skeletal system, hyperglobulinemia, Bence-Jones proteinuria and anemia. Complications of multiple myeloma are bone pain, hypercalcemia, renal failure and spinal cord compression. The aberrant antibodies that are produced lead to impaired humoral immunity and patients have a high prevalence of infection. Amyloidosis may develop in some patients. Multiple myeloma is part of a spectrum of diseases ranging from monoclonal gammopathy of unknown significance (MGUS) to plasma cell leukemia.
Keywords 3D-structure, Cell cycle, Cell division, Chromosomal rearrangement, Cyclin, Cytoplasm, DNA damage, Isopeptide bond, Membrane, Nucleus, Phosphoprotein, Proteomics identification, Proto-oncogene, Reference proteome, Repressor, Transcription, Transcription regulation, Ubl conjugation
Sequence MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
UniProt accession: P24385

Data

Human mantle cell lymphoma stained with anti-Cyclin D1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of lymphoma cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-Cyclin D1 monoclonal antibody (ZM178) specifically react with?

This antibody specifically reacts with human Cyclin D1 protein.

For which application is the mouse anti-Cyclin D1 monoclonal antibody (ZM178) validated and recommended?

It is validated and suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for the mouse anti-Cyclin D1 monoclonal antibody (ZM178)?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C while avoiding freeze/thaw cycles.

What is the immunogen used to generate the mouse anti-Cyclin D1 monoclonal antibody (ZM178)?

The immunogen is a synthetic peptide corresponding to residues within amino acids 200-295 of the Cyclin D1 protein.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.