Immunohistochemistry (IHC) : Human tonsil stained with anti-CD8 antibody using peroxidase-conjugate and DAB chromogen. Not the membrane staining of perifollicular T-cells.

mouse anti-CD8 monoclonal antibody (ZM54) 6114

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD8
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Lymph node
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6114parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD8, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD8 monoclonal antibody ZM54 6114

antibody
Database link: human P01732 Database link: human P01731
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Lymph node
Immunogen Human CD8 recombinant protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens CD8A T-cell surface glycoprotein CD8 alpha chain
Protein names T-cell surface glycoprotein CD8 alpha chain
Alternative names T-lymphocyte differentiation antigen T8/Leu-2
Gene names CD8A
Function Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells
Subcellular location Secreted
Structure Forms disulfide-linked heterodimers with CD8B at the cell surface. Also forms homodimers in several cell types including NK-cells or peripheral blood T-lymphocytes. Interacts with the MHC class I HLA-A/B2M dimer. One HLA-A molecule (mainly via nonpolymorphic alpha-3 domain) interacts with one CD8A homodimer (via CDR-like loop) (PubMed:2784196, PubMed:9177355). Interacts with LCK in a zinc-dependent manner. Interacts with HLA-G; this interaction is direct and might down-regulate T cell receptor signaling
Post-translational modification Palmitoylated, but association with CD8B seems to be more important for the enrichment of CD8A in lipid rafts O-glycosylated Phosphorylated in cytotoxic T-lymphocytes (CTLs) following activation
Involvement in disease Immunodeficiency 116 An autosomal recessive immunologic defect characterized by absence of CD8+ cells, leading to recurrent bacterial infections.
Keywords 3D-structure, Adaptive immunity, Alternative splicing, Cell membrane, Disease variant, Disulfide bond, Glycoprotein, Immunity, Immunoglobulin domain, Lipoprotein, Membrane, Palmitate, Proteomics identification, Reference proteome, Secreted, Signal, Transmembrane, Transmembrane helix
Sequence MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
UniProt accession: P01732

Data

Human tonsil stained with anti-CD8 antibody using peroxidase-conjugate and DAB chromogen. Not the membrane staining of perifollicular T-cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended application for the mouse anti-CD8 monoclonal antibody (ZM54) 6114?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

What species does the mouse anti-CD8 monoclonal antibody (ZM54) specifically react with?

The antibody specifically reacts with human CD8 protein.

How should the mouse anti-CD8 antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C while avoiding freeze/thaw cycles.

What is the clonality and isotype of the anti-CD8 monoclonal antibody ZM54 6114?

The antibody is a mouse monoclonal antibody of the IgG1 isotype.

Which secondary antibodies are compatible with the mouse anti-CD8 monoclonal antibody for detection?

Compatible secondary antibodies include goat anti-mouse IgG, H&L chain specific, conjugated with peroxidase, biotin, or FITC, including cross-absorbed versions.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.