Skip to content

mouse anti-CD79a monoclonal antibody (JCB117) 6113

Price range: $160.00 through $528.00

Antibody summary

  • Mouse monoclonal to CD79a
  • Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
  • Reacts with: Human
  • Isotype:IgG1/K
  • Control: Tonsil or lymph node
  • Visualization: Membrane
  • 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
SKU: 6113parent Categories: , Tags: , ,
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

mouse

isotype

IgG1/K

clonality

monoclonal

concentration

concentrate, predilute

applications

IHC

reactivity

human

available size

0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD79a monoclonal antibody JCB117 6113

antibody
Database link:
human P11912
Tested applications
IHC
Recommended dilutions
Concentrated 1:100-200
Application Notes
Positive control: Tonsil or lymph node
Immunogen
Synthetic peptide corresponding to aa 202-216 of human CD79a protein
Size and concentration
7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form
liquid
Storage Instructions
2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity
affinity purified
Clonality
monoclonal
Isotype
IgG1
Compatible secondaries
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486
goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854
goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706
goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716
goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control
Mouse monoclonal IgG1 - Isotype Control
target relevance
Homo sapiens CD79A
B-cell antigen receptor complex-associated protein alpha chain
Protein names
B-cell antigen receptor complex-associated protein alpha chain
Alternative names
Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein
Gene names
CD79A
Function
Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B-cells
Subcellular location
Cell membrane
Structure
Heterodimer of alpha and beta chains; disulfide-linked. Part of the B-cell antigen receptor complex where the alpha/beta chain heterodimer is non-covalently associated with an antigen-specific membrane-bound surface immunoglobulin of two heavy chains and two light chains (PubMed:35981043). Interacts through its phosphorylated ITAM domain with the SH2 domains of SYK which stimulates SYK autophosphorylation and activation. Also interacts, when phosphorylated on Tyr-210, with the SH2 domain of BLNK/SLP65, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK which is necessary for trafficking of the BCR to late endosomes. Interacts with Src-family tyrosine kinases including FYN and LYN, increasing their activity (By similarity)
Post-translational modification
Phosphorylated on tyrosine, serine and threonine residues upon B-cell activation. Phosphorylation of tyrosine residues by Src-family kinases is an early and essential feature of the BCR signaling cascade. The phosphorylated tyrosines serve as docking sites for SH2-domain containing kinases, leading to their activation which in turn leads to phosphorylation of downstream targets. Phosphorylated by LYN. Phosphorylation of serine and threonine residues may prevent subsequent tyrosine phosphorylation
Arginine methylation in the ITAM domain may interfere with the binding of SYK. It promotes signals leading to B-cell differentiation (By similarity)
Involvement in disease
Agammaglobulinemia 3, autosomal recessive
A primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B-cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life.

Keywords
3D-structure, Adaptive immunity, Alternative splicing, Cell membrane, Direct protein sequencing, Disulfide bond, Glycoprotein, Immunity, Immunoglobulin domain, Membrane, Methylation, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Signal, Transmembrane, Transmembrane helix
Sequence
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSN NANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCG TYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGD EYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
UniProt accession: P11912

Data

Human tonsil stained with anti-CD79a antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of follicular center and parafollicular B-cells.
Human tonsil stained with anti-CD79a antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of follicular center and parafollicular B-cells.

FAQ & Publications

Frequently Asked Questions
What species reactivity does the mouse anti-CD79a monoclonal antibody (JCB117) exhibit?
This antibody specifically reacts with human CD79a.
How should the mouse anti-CD79a monoclonal antibody (JCB117) be stored to maintain stability?
For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
IHC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.