Immunohistochemistry (IHC) : Human lymph node stained with anti-CD7antibody using peroxidase-conjugate and DAB chromogen. Note cell membrane staining of perifollicular T-cells cells.

mouse anti-CD7 monoclonal antibody (ZM213) 6108

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD7
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Tonsil or lymph node
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6108parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD7, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD7 monoclonal antibody ZM213 6108

antibody
Database link: human P09564
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Tonsil or lymph node
Immunogen Recombinant human full-length CD7 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens CD7 T-cell antigen CD7
Protein names T-cell antigen CD7
Alternative names GP40, T-cell leukemia antigen, T-cell surface antigen Leu-9, TP41
Gene names CD7
Function Transmembrane glycoprotein expressed by T-cells and natural killer (NK) cells and their precursors (PubMed:7506726). Plays a costimulatory role in T-cell activation upon binding to its ligand K12/SECTM1 (PubMed:10652336). In turn, mediates the production of cytokines such as IL-2 (PubMed:1709867). On resting NK-cells, CD7 activation results in a significant induction of interferon-gamma levels (PubMed:7506726)
Subcellular location Membrane
Structure Interacts with SECTM1
Keywords Adaptive immunity, Disulfide bond, Glycoprotein, Immunity, Immunoglobulin domain, Lipoprotein, Membrane, Palmitate, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEV NVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
UniProt accession: P09564

Data

Human lymph node stained with anti-CD7antibody using peroxidase-conjugate and DAB chromogen. Note cell membrane staining of perifollicular T-cells cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-CD7 monoclonal antibody (ZM213) specifically react with?

This antibody specifically reacts with human CD7 protein, making it suitable for studies involving human samples.

What are the recommended storage conditions for maintaining the stability of this antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and repeated freeze/thaw cycles should be avoided to preserve antibody integrity.

Which applications and sample types is this mouse anti-CD7 antibody validated for?

The antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples, with tonsil or lymph node tissue recommended as positive controls.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.