Immunohistochemistry (IHC) : Human colon stained with anti-CD68 antibody using peroxidase conjugate and DAB chromogen. Note intense cytoplasmic staining of glandular cells.

mouse anti-CD68 monoclonal antibody (KP1) 6106

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD68
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Tonsil, lymph node, spleen
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6106parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD68, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD68 monoclonal antibody KP1 6106

antibody
Database link: human P34810
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil, lymph node, spleen
Immunogen Subcellular fraction of human alveolar macrophages
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens CD68 Macrosialin
Protein names Macrosialin
Alternative names Gp110
Gene names CD68
Protein family Belongs to the LAMP family
Function Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells
Subcellular location Endosome membrane, Lysosome membrane
Post-translational modification N- and O-glycosylated
Keywords Alternative splicing, Cell membrane, Disulfide bond, Endosome, Glycoprotein, Lysosome, Membrane, Proteomics identification, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTT THRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNAT VHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRV MYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSY MAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAA QLPHTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSAYQAL
UniProt accession: P34810

Data

Human colon stained with anti-CD68 antibody using peroxidase conjugate and DAB chromogen. Note intense cytoplasmic staining of glandular cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-CD68 monoclonal antibody (KP1) 6106 react with?

This antibody reacts specifically with human tissues.

How should the mouse anti-CD68 monoclonal antibody (KP1) 6106 be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store at -20°C and avoid repeated freeze/thaw cycles.

What applications is the mouse anti-CD68 monoclonal antibody (KP1) 6106 suitable for?

This antibody is suitable for immunohistochemistry, particularly on formalin-fixed, paraffin-embedded tissues.

What is the recommended dilution range for using the concentrated form of the mouse anti-CD68 monoclonal antibody (KP1) 6106 in IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.