Immunohistochemistry (IHC) : Human tonsil stained with anti-CD5 antibody using peroxidase-conjugate and DAB chromogen. Note cell membrane staining of T cells.

mouse anti-CD5 monoclonal antibody (ZM61) 6100

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD5
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Tonsil
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6100parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD5, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD5 monoclonal antibody ZM61 6100

antibody
Database link: human P06127
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Positive control: Tonsil
Immunogen Recombinant human CD5 protein fragment (around aa 269-366) (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens CD5 T-cell surface glycoprotein CD5
Protein names T-cell surface glycoprotein CD5
Alternative names Lymphocyte antigen T1/Leu-1
Gene names CD5
Function Lymphoid-specific receptor expressed by all T-cells and in a subset of B-cells known as B1a cells. Plays a role in the regulation of TCR and BCR signaling, thymocyte selection, T-cell effector differentiation and immune tolerance. Acts by interacting with several ligands expressed on B-cells such as CD5L or CD72 and thereby plays an important role in contact-mediated, T-dependent B-cell activation and in the maintenance of regulatory T and B-cell homeostasis. Functions as a negative regulator of TCR signaling during thymocyte development by associating with several signaling proteins including LCK, CD3Z chain, PI3K or CBL (PubMed:1384049, PubMed:1385158). Mechanistically, co-engagement of CD3 with CD5 enhances phosphorylated CBL recruitment leading to increased VAV1 phosphorylation and degradation (PubMed:23376399). Modulates B-cell biology through ERK1/2 activation in a Ca(2+)-dependent pathway via the non-selective Ca(2+) channel TRPC1, leading to IL-10 production (PubMed:27499044)
Subcellular location Cell membrane
Structure Interacts with CD72/LYB-2 (PubMed:1711157). Interacts with PTPN6/SHP-1 (By similarity). Interacts with CBL (PubMed:23376399). Interacts with CD5L (By similarity). Interacts with CD3Z/CD247 (PubMed:1384049, PubMed:1385158)
Post-translational modification Phosphorylated on serine, threonine and tyrosine residues following TCR stimulation (PubMed:1385158). Phosphorylated by LCK on Tyr-453 and Tyr-487 upon TCR engagement
Keywords 3D-structure, Cell membrane, Disulfide bond, Glycoprotein, Membrane, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVC SQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHS RNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGS LGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQ NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAAL CDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYC KKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGP TGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPD NSSDSDYDLHGAQRL
UniProt accession: P06127

Data

Human tonsil stained with anti-CD5 antibody using peroxidase-conjugate and DAB chromogen. Note cell membrane staining of T cells.

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-CD5 monoclonal antibody (ZM61) suitable for?

This antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue sections.

How should the mouse anti-CD5 monoclonal antibody (ZM61) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term storage, freeze at -20°C and avoid repeated freeze/thaw cycles.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.