Immunohistochemistry (IHC) : Human tonsil stained with anti-CD23 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of follicular dendritic cells.

mouse anti-CD23 monoclonal antibody (ZM209) 6079

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD23
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Tonsil
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6079parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD23, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD23 monoclonal antibody ZM209 6079

antibody
Database link: human P06734
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tonsil
Immunogen Recombinant fragment (around aa 48-321) of human FCER2/CD23 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens FCER2 Low affinity immunoglobulin epsilon Fc receptor
Protein names Low affinity immunoglobulin epsilon Fc receptor
Alternative names BLAST-2, C-type lectin domain family 4 member J, Fc-epsilon-RII, Immunoglobulin E-binding factor, Lymphocyte IgE receptor
Gene names FCER2
Function Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B cells. On B cells, initiates IgE-dependent antigen uptake and presentation to T cells (PubMed:2167225). On macrophages, upon IgE binding and antigen cross-linking induces intracellular killing of parasites through activation of L-Arginine-nitric oxide pathway (PubMed:7544003)
Subcellular location Cell membrane, Cell membrane, Secreted
Structure Homotrimer. Interacts (via C-type lectin domain) with IGHE (via CH3 region); this interaction regulates IgE homeostasis. Interacts (via the C-terminus) with CR2/CD21 (via Sushi domain 1 and 2) (PubMed:1386409, PubMed:16172256)
Post-translational modification N- and O-glycosylated The secreted form sCD23 is produced by ADAM10-mediated ectodomain shedding
Keywords 3D-structure, Calcium, Cell membrane, Direct protein sequencing, Disulfide bond, Glycoprotein, IgE-binding protein, Lectin, Lipoprotein, Membrane, Metal-binding, Palmitate, Proteoglycan, Proteomics identification, Receptor, Reference proteome, Repeat, Secreted, Signal-anchor, Transmembrane, Transmembrane helix
Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERA ARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADL SSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKG TKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHV DYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM GPDSRPDPDGRLPTPSAPLHS
UniProt accession: P06734

Data

Human tonsil stained with anti-CD23 antibody using peroxidase-conjugate and DAB chromogen. Note the membranous staining of follicular dendritic cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-CD23 monoclonal antibody (ZM209) specifically react with?

This antibody specifically reacts with human CD23 protein and is suitable for immunohistochemistry applications using human tissues.

How should the mouse anti-CD23 monoclonal antibody (ZM209) be stored to maintain its stability and activity?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze-thaw cycles to maintain antibody integrity.

What is the recommended dilution for immunohistochemistry when using the concentrated form of this anti-CD23 antibody?

The concentrated antibody is recommended to be diluted between 1:100 and 1:200 for immunohistochemistry on formalin-fixed, paraffin-embedded human tissue sections.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.