Immunohistochemistry (IHC) : Human lymph node stained with anti-CD20 antibody using peroxidase-conjugate and DAB chromogen. Note the membrane and cytoplasmic staining of B-cells in mantle and follicle.

mouse anti-CD20 monoclonal antibody (L26) 6073

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD20
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Tonsil, lymph node
Visualization: Cell membrane/cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6073parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD20, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD20 monoclonal antibody L26 6073

antibody
Database link: human P11836
Tested applications IHC
Recommended dilutions Concentrated 1:100-300
Application Notes Positive control: Tonsil, lymph node
Immunogen Human tonsil B cells
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens MS4A1 B-lymphocyte antigen CD20
Protein names B-lymphocyte antigen CD20
Alternative names B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1
Gene names MS4A1
Protein family Belongs to the MS4A family
Function B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes (PubMed:12920111, PubMed:3925015, PubMed:7684739). Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR (PubMed:12920111, PubMed:18474602, PubMed:7684739)
Subcellular location Cell membrane, Cell membrane
Structure Forms homotetramers (PubMed:18474602, PubMed:7684739). Interacts with the heavy and light chains of cell surface IgM, the antigen-binding components of the BCR (PubMed:18474602)
Post-translational modification Phosphorylated on serines and threonines in resting B-cells. Protein kinase C/PKC can use CD20 as substrate
Involvement in disease Immunodeficiency, common variable, 5 A primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low.
Keywords 3D-structure, Alternative splicing, B-cell activation, Cell membrane, Disulfide bond, Lipoprotein, Membrane, Palmitate, Pharmaceutical, Phosphoprotein, Proteomics identification, Reference proteome, Transmembrane, Transmembrane helix
Sequence MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
UniProt accession: P11836

Data

Human lymph node stained with anti-CD20 antibody using peroxidase-conjugate and DAB chromogen. Note the membrane and cytoplasmic staining of B-cells in mantle and follicle.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution range for the concentrated mouse anti-CD20 monoclonal antibody (L26) 6073 when used in immunohistochemistry?

The recommended dilution for the concentrated mouse anti-CD20 monoclonal antibody (L26) 6073 in immunohistochemistry (IHC) applications is between 1:100 and 1:300.

How should the mouse anti-CD20 monoclonal antibody (L26) 6073 be stored to maintain its stability?

For short-term storage, the mouse anti-CD20 monoclonal antibody (L26) 6073 should be kept at 2-8°C. For long-term storage, it is recommended to store the antibody at -20°C and to avoid repeated freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.