Immunohistochemistry (IHC) : Human Hodgkin lymphoma stained with anti-CD15 antibody using peroxidase conjugate and DAB chromogen. Note membranous staining of Reed-Sternberg cells.

mouse anti-CD15 monoclonal antibody (MMA) 6064

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to CD15
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgM
Control: Hodgkin lymphoma
Visualization: Cell membrane and granular perinuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6064parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, CD15, Hematopathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgM
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-CD15 monoclonal antibody MMA 6064

antibody
Database link: human P22083
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Hodgkin lymphoma
Immunogen Glycoprotein fraction of human lymphocytes
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgM
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgM - Isotype Control

target relevance
Homo sapiens FUT4 Alpha-(1,3)-fucosyltransferase 4
Protein names Alpha-(1,3)-fucosyltransferase 4
Alternative names 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase, ELAM-1 ligand fucosyltransferase, Fucosyltransferase 4, Fucosyltransferase IV, Galactoside 3-L-fucosyltransferase
Gene names FUT4
Protein family Belongs to the glycosyltransferase 10 family
Function Catalyzes alpha(1->3) linkage of fucosyl moiety transferred from GDP-beta-L-fucose to N-acetyl glucosamine (GlcNAc) within type 2 lactosamine (LacNAc, Gal-beta(1->4)GlcNAc) glycan attached to N- or O-linked glycoproteins (PubMed:1702034, PubMed:1716630, PubMed:29593094). Robustly fucosylates nonsialylated distal LacNAc unit of the polylactosamine chain to form Lewis X antigen (CD15), a glycan determinant known to mediate important cellular functions in development and immunity. Fucosylates with lower efficiency sialylated LacNAc acceptors to form sialyl Lewis X and 6-sulfo sialyl Lewis X determinants that serve as recognition epitopes for C-type lectins (PubMed:1716630, PubMed:29593094). Together with FUT7 contributes to SELE, SELL and SELP selectin ligand biosynthesis and selectin-dependent lymphocyte homing, leukocyte migration and blood leukocyte homeostasis (By similarity). In a cell type specific manner, may also fucosylate the internal LacNAc unit of the polylactosamine chain to form VIM-2 antigen that serves as recognition epitope for SELE (PubMed:11278338, PubMed:1716630)
Catalytic activity a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = a beta-D-galactosyl-(1->4)-[alpha-L-fucosyl-(1->3)]-N-acetyl-beta-D-glucosaminyl derivative + GDP + H(+) an N-acetyl-alpha-neuraminyl-(2->3)-beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + GDP-beta-L-fucose = an alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc derivative + GDP + H(+) an alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc derivative + GDP-beta-L-fucose = an alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc derivative + GDP + H(+) an alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc6S derivative + GDP-beta-L-fucose = an alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->4)-[alpha-L-Fuc-(1->3)]-beta-D-GlcNAc6S derivative + GDP + H(+)
Subcellular location Golgi apparatus, Golgi stack membrane
Keywords Alternative initiation, Glycoprotein, Glycosyltransferase, Golgi apparatus, Inflammatory response, Membrane, Proteomics identification, Reference proteome, Signal-anchor, Transferase, Transmembrane, Transmembrane helix
Sequence MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALA ARPARHLGGAGQGPRPLHSGTAPFHSRASGERQRRLEPQLQHESRCRSSTPADAWRAEAA LPVRAMGAPWGSPTAAAGGRRGWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPW ASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHR DLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESP SHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWV VSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLD YITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPA VYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER
UniProt accession: P22083

Data

Human Hodgkin lymphoma stained with anti-CD15 antibody using peroxidase conjugate and DAB chromogen. Note membranous staining of Reed-Sternberg cells.

FAQ & Publications

Frequently Asked Questions

What species reactivity does the mouse anti-CD15 monoclonal antibody (MMA) 6064 exhibit?

This antibody reacts specifically with human species.

Which applications is the mouse anti-CD15 monoclonal antibody (MMA) 6064 validated for?

It is suitable and tested for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

How should the mouse anti-CD15 monoclonal antibody (MMA) 6064 be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C; for long-term storage, it should be kept at -20°C. Avoid repeated freeze-thaw cycles.

What is the recommended dilution range when using the concentrated form of this anti-CD15 antibody for IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is between 1:100 and 1:200.

What is the immunogen used to generate the mouse anti-CD15 monoclonal antibody (MMA) 6064?

The antibody was raised against a glycoprotein fraction derived from human lymphocytes.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.