Immunohistochemistry (IHC) : Human mesothelioma stained with anti-calretinin antibody using peroxidase-conjugate and DAB chromogen. Note nuclear/cytoplasmic staining of mesothelioma cells.

mouse anti-Calretinin monoclonal antibody (ZM85) 6052

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to Calretinin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Mesothelioma
Visualization: Cytoplasmic and nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6052parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Calretinin, Lung/Mediastinum Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-Calretinin monoclonal antibody ZM85 6052

antibody
Database link: human P22676
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Mesothelioma
Immunogen Recombinant human Calretinin (Calbindin 2) protein fragment (around aa23-242)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens CALB2 Calretinin
Protein names Calretinin
Alternative names 29 kDa calbindin
Gene names CALB2
Protein family Belongs to the calbindin family
Function Calcium-binding protein involved in calcium homeostasis and signal transduction. It plays a critical role in buffering intracellular calcium levels and modulating calcium-dependent signaling pathways (PubMed:2001709). Predominantly expressed in specific neuronal populations, influences synaptic plasticity and neuronal excitability, contributing to learning and memory (By similarity). During embryonic development, it facilitates neuronal differentiation and maturation (By similarity)
Subcellular location Synapse, Cell projection, dendrite
Keywords Calcium, Cell projection, Metal-binding, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Synapse
Sequence MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSK SDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYD TDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL PVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQL TNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM
UniProt accession: P22676

Data

Human mesothelioma stained with anti-calretinin antibody using peroxidase-conjugate and DAB chromogen. Note nuclear/cytoplasmic staining of mesothelioma cells.

FAQ & Publications

Frequently Asked Questions

What applications is the mouse anti-Calretinin monoclonal antibody (ZM85) suitable for?

This antibody is recommended for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, particularly for detecting Calretinin in human samples.

How should the mouse anti-Calretinin antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze-thaw cycles to maintain antibody integrity.

What is the recommended dilution for using the concentrated mouse anti-Calretinin monoclonal antibody in IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is between 1:100 and 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.