Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human pancreatic ductal carcinoma stained with anti-keratin 19 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells

rabbit anti-Cytokeratin 19 monoclonal antibody (ZR143) 6141

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Cytokeratin 19
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Breast carcinoma
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6141parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Cytokeratin 19, General & Epithelial Markers

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Cytokeratin 19 monoclonal antibody ZR143 6141

antibody
Database link: human P08727
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Breast carcinoma
Immunogen Recombinant human full-length KRT19 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens KRT19 Keratin, type I cytoskeletal 19
Protein names Keratin, type I cytoskeletal 19
Alternative names Cytokeratin-19, Keratin-19
Gene names KRT19
Protein family Belongs to the intermediate filament family
Function Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle
Structure (Microbial infection) Interacts with hepatitis C virus/HCV core protein
Keywords 3D-structure, Coiled coil, Direct protein sequencing, Host-virus interaction, Intermediate filament, Keratin, Methylation, Phosphoprotein, Proteomics identification, Reference proteome
Sequence MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
UniProt accession: P08727

Data

Formalin-fixed, paraffin-embedded human pancreatic ductal carcinoma stained with anti-keratin 19 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-Cytokeratin 19 monoclonal antibody (ZR143) validated for?

This antibody is suitable for immunohistochemistry (IHC) applications, specifically on formalin-fixed, paraffin-embedded human tissue samples.

How should the rabbit anti-Cytokeratin 19 monoclonal antibody (ZR143) be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.