Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human breast carcinoma stained with anti-VEGF antibody using peroxidase-conjugate and DAB chromogen. Note the cell surface and cytoplasmic staining of tumor cells

rabbit anti-VEGF monoclonal antibody (ZR389) 6401

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to VEGF
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Tumor cells in astrocytomas, breast or ovarian carcinomas
Visualization: Cytoplasm, cell surface
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6401parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, General & Epithelial Markers, VEGF

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-VEGF monoclonal antibody ZR389 6401

antibody
Database link: human P15692
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Tumor cells in astrocytomas, breast or ovarian carcinomas
Immunogen Recombinant fragment (around aa1-200) of human VEGFA protein (exact sequence is proprietary)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens VEGFA Vascular endothelial growth factor A, long form
Protein names Vascular endothelial growth factor A, long form
Alternative names Vascular permeability factor
Gene names VEGFA
Protein family Belongs to the PDGF/VEGF growth factor family
Function Participates in the induction of key genes involved in the response to hypoxia and in the induction of angiogenesis such as HIF1A (PubMed:35455969). Involved in protecting cells from hypoxia-mediated cell death (By similarity)
Subcellular location Secreted
Structure Homodimer; disulfide-linked (By similarity). Also found as heterodimer with PGF (By similarity). Interacts with NRP1 (PubMed:26503042). Interacts with isoform 2 of BSG (PubMed:25825981). Interacts with CD82; this interaction inhibits VEGFA-mediated signaling pathway (PubMed:34530889)
Post-translational modification Produced by use of an alternative upstream CUG codon and post-translationally processed into the N-terminal N-VEGF form and the C-terminal secreted VEGFA form
Involvement in disease Microvascular complications of diabetes 1 Pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
Keywords 3D-structure, Alternative initiation, Alternative promoter usage, Alternative splicing, Angiogenesis, Cytoplasm, Developmental protein, Differentiation, Direct protein sequencing, Disulfide bond, Endoplasmic reticulum, Extracellular matrix, Glycoprotein, Golgi apparatus, Growth factor, Heparin-binding, Mitogen, Nucleus, Proteomics identification, Reference proteome, Secreted
Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLG CSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWT GEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASET MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQ DPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
UniProt accession: P15692

Data

Formalin-fixed, paraffin-embedded human breast carcinoma stained with anti-VEGF antibody using peroxidase-conjugate and DAB chromogen. Note the cell surface and cytoplasmic staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species reactivity does the rabbit anti-VEGF monoclonal antibody (ZR389) exhibit?

The rabbit anti-VEGF monoclonal antibody (ZR389) is reactive with human VEGF protein.

How should the rabbit anti-VEGF monoclonal antibody (ZR389) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be stored at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.