Immunohistochemistry (IHC) : Human neuroendocrine tumor stained with anti-Synaptophysin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

rabbit anti-Synaptophysin monoclonal antibody (ZR445) 6374

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Synaptophysin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Pancreas
Visualization: Cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6374parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, Neuropathology/Endocrine, Synaptophysin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Synaptophysin monoclonal antibody ZR445 6374

antibody
Database link: human P08247
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Pancreas
Immunogen Recombinant fragment (around aa 224-313) of human Synaptophysin (SYP) protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens SYP Synaptophysin
Protein names Synaptophysin
Alternative names Major synaptic vesicle protein p38
Gene names SYP
Protein family Belongs to the synaptophysin/synaptobrevin family
Function Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity (By similarity)
Subcellular location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Synapse, synaptosome
Structure Homohexamer or homotetramer. Interacts with SRCIN1 (PubMed:18662323). Interacts with VAMP2; the interaction is inhibited by interaction of VAPM2 with SEPT8 (By similarity)
Post-translational modification Ubiquitinated; mediated by SIAH1 or SIAH2 and leading to its subsequent proteasomal degradation Phosphorylated by SRC
Involvement in disease Intellectual developmental disorder, X-linked 96 A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period.
Keywords Alternative splicing, Calcium, Cytoplasmic vesicle, Disease variant, Glycoprotein, Intellectual disability, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Synapse, Synaptosome, Transmembrane, Transmembrane helix, Ubl conjugation
Sequence MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANK TESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMG ALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEM PVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAP EKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGY GPQGAPTSFSNQM
UniProt accession: P08247

Data

Human neuroendocrine tumor stained with anti-Synaptophysin antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Synaptophysin monoclonal antibody (ZR445) specifically react with?

This antibody specifically reacts with human Synaptophysin protein.

How should the rabbit anti-Synaptophysin antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided to preserve antibody integrity.

What applications and dilutions are recommended for using this antibody in immunohistochemistry?

The antibody is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues. The recommended dilution for the concentrated antibody is between 1:100 to 1:200, with pancreas tissue serving as a positive control.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.