Immunohistochemistry (IHC) : Human colon carcinoma stained with MGMT antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

rabbit anti-MGMT monoclonal antibody (ZR434) 6254

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to MGMT
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Colon carcinoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6254parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, MGMT, monoclonal, Neuropathology/Endocrine

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-MGMT monoclonal antibody ZR434 6254

antibody
Database link: human P16455
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Colon carcinoma
Immunogen Purified His-tagged MGMT protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens MGMT Methylated-DNA--protein-cysteine methyltransferase
Protein names Methylated-DNA--protein-cysteine methyltransferase
Alternative names 6-O-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase
Gene names MGMT
Protein family Belongs to the MGMT family
Function Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated
Catalytic activity a 6-O-methyl-2'-deoxyguanosine in DNA + L-cysteinyl-[protein] = S-methyl-L-cysteinyl-[protein] + a 2'-deoxyguanosine in DNA a 4-O-methyl-thymidine in DNA + L-cysteinyl-[protein] = a thymidine in DNA + S-methyl-L-cysteinyl-[protein]
Subcellular location Nucleus
Keywords 3D-structure, Direct protein sequencing, DNA damage, DNA repair, DNA-binding, Metal-binding, Methyltransferase, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transferase, Zinc
Sequence MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG LGGSSGLAGAWLKGAGATSGSPPAGRN
UniProt accession: P16455

Data

Human colon carcinoma stained with MGMT antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-MGMT monoclonal antibody (ZR434) specifically react with?

This antibody is reactive with human species and is suitable for immunohistochemistry applications involving human tissue samples.

How should the rabbit anti-MGMT monoclonal antibody (ZR434) be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.