Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human pituitary stained with anti-PIT-1 antibody using peroxidase-conjugate and DAB chromogen. Note strong nuclear staining of glandular cells

rabbit anti-PIT-1/POU1F1 monoclonal antibody (ZR440) 6335

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PIT-1/POU1F1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Pituitary
Visualization: Nucleus
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6335parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, Neuropathology/Endocrine, PIT-1/POU1F1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PIT-1/POU1F1 monoclonal antibody ZR440 6335

antibody
Database link: human P28069
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Pituitary
Immunogen Recombinant human full-length POU1F1 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens POU1F1 Pituitary-specific positive transcription factor 1
Protein names Pituitary-specific positive transcription factor 1
Alternative names Growth hormone factor 1
Gene names POU1F1
Protein family Belongs to the POU transcription factor family. Class-1 subfamily
Function Transcription factor involved in the specification of the lactotrope, somatotrope, and thyrotrope phenotypes in the developing anterior pituitary. Specifically binds to the consensus sequence 5'-TAAAT-3'. Activates growth hormone and prolactin genes (PubMed:22010633, PubMed:26612202)
Subcellular location Nucleus
Structure Interacts with PITX1 (PubMed:26612202). Interacts with LHX3 (PubMed:26612202). Interacts with ELK1 (PubMed:26612202)
Involvement in disease Pituitary hormone deficiency, combined, 1 Combined pituitary hormone deficiency is defined as the impaired production of growth hormone and one or more of the other five anterior pituitary hormones. CPHD1 is characterized by pleiotropic deficiencies of growth hormone, prolactin and thyroid-stimulating hormone, while the production of adrenocorticotropic hormone, luteinizing hormone, and follicle-stimulating hormone are preserved. In infancy severe growth deficiency from birth as well as distinctive facial features with prominent forehead, marked midfacial hypoplasia with depressed nasal bridge, deep-set eyes, and a short nose with anteverted nostrils and hypoplastic pituitary gland by MRI examination can be seen. Some cases present with severe intellectual disability along with short stature.
Keywords 3D-structure, Activator, Alternative splicing, Disease variant, DNA-binding, Dwarfism, Homeobox, Nucleus, Proteomics identification, Reference proteome, Transcription, Transcription regulation
Sequence MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHY GNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEE PIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSF KNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPS SQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
UniProt accession: P28069

Data

Formalin-fixed, paraffin-embedded human pituitary stained with anti-PIT-1 antibody using peroxidase-conjugate and DAB chromogen. Note strong nuclear staining of glandular cells

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution for using the rabbit anti-PIT-1/POU1F1 monoclonal antibody (ZR440) in immunohistochemistry?

The recommended dilution for the concentrated form of the rabbit anti-PIT-1/POU1F1 monoclonal antibody (ZR440) in immunohistochemistry is 1:100 to 1:200.

How should the rabbit anti-PIT-1/POU1F1 monoclonal antibody (ZR440) be stored to ensure stability?

For short-term storage, the antibody should be kept at 2-8°C. For longer-term storage, it should be kept at -20°C, and repeated freeze/thaw cycles should be avoided to maintain antibody stability.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.