Immunohistochemistry (IHC) : Human cerebrum stained with anti-Olig 2 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of oligodendroglial cells.

rabbit anti-Olig2 monoclonal antibody (ZR340) 6301

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Olig2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Astrocytoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6301parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, Neuropathology/Endocrine, Olig2

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Olig2 monoclonal antibody ZR340 6301

antibody
Database link: human Q13516
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Astrocytoma
Immunogen Fragment (around aa 200-300) of human Olig2 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens OLIG2 Oligodendrocyte transcription factor 2
Protein names Oligodendrocyte transcription factor 2
Alternative names Class B basic helix-loop-helix protein 1, Class E basic helix-loop-helix protein 19, Protein kinase C-binding protein 2, Protein kinase C-binding protein RACK17
Gene names OLIG2
Function Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Functions together with ZNF488 to promote oligodendrocyte differentiation. Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube. Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development
Subcellular location Nucleus, Cytoplasm
Structure Interacts with NKX2-2. Interacts with ZNF488
Keywords Chromosomal rearrangement, Cytoplasm, Developmental protein, DNA-binding, Nucleus, Proteomics identification, Proto-oncogene, Reference proteome, Transcription, Transcription regulation
Sequence MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS ASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV PPPHHHVSAMGAGSLPRLTSDAK
UniProt accession: Q13516

Data

Human cerebrum stained with anti-Olig 2 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of oligodendroglial cells.

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-Olig2 monoclonal antibody (ZR340) validated for?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

What is the recommended dilution for using the concentrated form of this anti-Olig2 antibody in IHC?

The recommended dilution for the concentrated antibody in immunohistochemistry is between 1:100 and 1:200.

How should the rabbit anti-Olig2 monoclonal antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, and freeze/thaw cycles should be avoided.

Which species does this anti-Olig2 antibody specifically react with?

This antibody specifically reacts with human Olig2 protein.

What type of antibody is the rabbit anti-Olig2 monoclonal antibody (ZR340) in terms of clonality and host species?

It is a monoclonal antibody produced in rabbit.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.