| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | SODD (NT) |
| available sizes | 100 µg |
rabbit anti-SODD (NT) polyclonal antibody 5658
$445.00
Antibody summary
- Rabbit polyclonal to SODD (NT)
- Suitable for: ELISA,WB,ICC,IF
- Isotype: IgG
- 100 µg
rabbit anti-SODD (NT) polyclonal antibody 5658
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting : use at 1ug/mL. Positive control: HeLa or THP-1 cell lysate. Immunocytochemistry: use at 5ug/mL These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Synthetic peptide corresponding to aa 2-16 of human SODD (accession no. AF111116). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens BAG4 BAG family molecular chaperone regulator 4 |
| Protein names BAG family molecular chaperone regulator 4 |
| Alternative names Bcl-2-associated athanogene 4, Silencer of death domains |
| Gene names BAG4 |
| Function Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release (By similarity). Prevents constitutive TNFRSF1A signaling. Negative regulator of PRKN translocation to damaged mitochondria |
| Subcellular location Cytoplasm |
| Structure Binds to the ATPase domain of HSP/HSC70 chaperones. Binds to the death domain of TNFRSF1A in the absence of TNF and thereby prevents binding of adapter molecules such as TRADD or TRAF2. Binds to the death domain of TNFRSF12. Interacts with PRKN |
| Keywords 3D-structure, Alternative splicing, Chaperone, Cytoplasm, Methylation, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAET TWLGEGGGGDGYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVR PELQGQSLNSYTNGAYGPTYPPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRSSGNSP TPVSRWIYPQQDCQTEAPPLRGQVPGYPPSQNPGMTLPHYPYGDGNRSVPQSGPTVRPQE DAWASPGAYGMGGRYPWPSSAPSAPPGNLYMTESTSPWPSSGSPQSPPSPPVQQPKDSSY PYSQSDQSMNRHNFPCSVHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGNATSDHPNNQD QSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKEL LELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL |
| UniProt accession: O95429 |
Data
 |
| Western blot analysis of SODD in HeLa (1,3) and THP-1 (2,4) whole cell lysates in the absence (1,2) or presence (3,4) of blocking peptide (Catalog no. 5658P) with SODD antibody at 1:500 dilution. |
 |
| Immunocytochemistry of SODD in HeLa cells with SODD antibody at 5 µg/mL. |
 |
| Immunofluorescence of SODD in Hela cells with SODD antibody at 20 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-SODD (NT) polyclonal antibody 5658 been validated for?
The rabbit anti-SODD (NT) polyclonal antibody 5658 has been tested and validated for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA applications.
How should the rabbit anti-SODD (NT) polyclonal antibody 5658 be stored to maintain stability?
This antibody is stable for at least one year when stored at -20°C. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.