| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | SIRPα |
| available sizes | 100 µg |
rabbit anti-SIRP α (CT) polyclonal antibody 9535
$478.00
Antibody summary
- Rabbit polyclonal to SIRP α (CT)
- Suitable for: ELISA,WB,ICC
- Isotype: IgG
- 100 µg
rabbit anti-SIRP α (CT) polyclonal antibody 9535
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 0.5-2ug/mL. A band of 75-110kDa is detected. Immunocytochemistry: use at 1-5ug/mL. These are recommended concentrations. Endusers should determine optimal concentrations for their applications. |
| Immunogen Synthetic peptide corresponding to 17 amino acids within the last 50 amino acids at the C-terminus of human SIRPa. |
| Size and concentration 100µg and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable at 4°C for three months and for at least one year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, 0.02% NaN3. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens SIRPA Tyrosine-protein phosphatase non-receptor type substrate 1 |
| Protein names Tyrosine-protein phosphatase non-receptor type substrate 1 |
| Alternative names Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MyD-1 antigen, Signal-regulatory protein alpha-1, Signal-regulatory protein alpha-2, Signal-regulatory protein alpha-3, p84 |
| Gene names SIRPA |
| Function Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function (By similarity). Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Plays a role in antiviral immunity and limits new world arenavirus infection by decreasing virus internalization (By similarity). Receptor for THBS1 (PubMed:24511121). Interaction with THBS1 stimulates phosphorylation of SIRPA (By similarity). In response to THBS1, involved in ROS signaling in non-phagocytic cells, stimulating NADPH oxidase-derived ROS production (PubMed:24511121) |
| Subcellular location Membrane |
| Structure Binds PTPN11 when tyrosine-phosphorylated, except in macrophages, where it primarily binds PTPN6. Binds GRB2 in vitro. Binds FGR (By similarity). Binds JAK2 irrespective of its phosphorylation status and forms a stable complex. Binds SCAP1 and/or SCAP2. The resulting complex recruits FYB1. Binds PTK2B. Interacts with TRIM2 (By similarity) |
| Post-translational modification N-glycosylated Phosphorylated on tyrosine residues in response to stimulation with EGF, growth hormone, insulin and PDGF. Dephosphorylated by PTPN11 |
| Keywords 3D-structure, Alternative splicing, Disulfide bond, Glycoprotein, Immunoglobulin domain, Membrane, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, SH3-binding, Signal, Transmembrane, Transmembrane helix |
| Sequence MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSL IPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYY CVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPL RGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAS TVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNT AAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEKNAREI TQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNR TPKQPAPKPEPSFSEYASVQVPRK |
| UniProt accession: P78324 |
Data
![]() |
| Western blot analysis of SIRP alpha in THP-1 whole cell lysate with SIRP alpha antibody at 0.5 µg/mL. |
![]() |
| Immunocytochemistry of SIRP alpha in THP-1 cells with SIRP alpha antibody at 1 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-SIRP α (CT) polyclonal antibody 9535 been tested for, and what are the recommended working dilutions?
This antibody has been validated for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA. Recommended dilutions are 0.5-2 µg/mL for immunoblotting and 1-5 µg/mL for immunocytochemistry. However, users should optimize concentrations for their specific experimental conditions.
How should the rabbit anti-SIRP α (CT) polyclonal antibody 9535 be stored to maintain stability?
The antibody is stable for three months when stored at 4°C and for at least one year at -20°C. It is advised to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-SIRP α (CT) polyclonal antibody 9535, and what target does it recognize?
The immunogen is a synthetic peptide corresponding to 17 amino acids within the last 50 amino acids at the C-terminus of human SIRPα. The antibody specifically recognizes the Signal-regulatory protein alpha (SIRPα), a membrane protein involved in cell signaling and immune regulation.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.











Reviews
There are no reviews yet.