| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
rabbit anti-S100P monoclonal antibody (ZR115) 6435
Price range: $160.00 through $528.00
Antibody summary
- Rabbit monoclonal to S100P
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG
- Control: Colon cancer
- Visualization: Membranous
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
rabbit anti-S100P monoclonal antibody ZR115 6435
| target relevance |
|---|
| Homo sapiens S100P Protein S100-P |
| Protein names Protein S100-P |
| Alternative names Migration-inducing gene 9 protein, Protein S100-E, S100 calcium-binding protein P |
| Gene names S100P |
| Protein family Belongs to the S-100 family |
| Function May function as calcium sensor and contribute to cellular calcium signaling. In a calcium-dependent manner, functions by interacting with other proteins, such as EZR and PPP5C, and indirectly plays a role in physiological processes like the formation of microvilli in epithelial cells. May stimulate cell proliferation in an autocrine manner via activation of the receptor for activated glycation end products (RAGE) |
| Subcellular location Nucleus, Cytoplasm, Cell projection, microvillus membrane |
| Structure (Microbial infection) Interacts with P.falciparum (strains 3D7 and FVO) MSP1 subunit p33; the interaction blocks S100P inflammatory and chemotactic activities |
| Keywords 3D-structure, Calcium, Cell membrane, Cell projection, Cytoplasm, Direct protein sequencing, Membrane, Metal-binding, Nucleus, Proteomics identification, Reference proteome, Repeat |
| Sequence MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKD LDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK |
| UniProt accession: P25815 |
Data
 |
| Formalin-fixed, paraffin-embedded human pancreatic ductal carcinoma stained with anti-S100P antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor cells |
FAQ & Publications
Frequently Asked Questions
What species does the rabbit anti-S100P monoclonal antibody (ZR115) specifically react with?
This antibody specifically reacts with human S100P protein.
What are the recommended storage conditions for the rabbit anti-S100P monoclonal antibody (ZR115)?
Store the antibody at 2-8°C for short term and at -20°C for longer term storage, avoiding freeze/thaw cycles.
In which applications has the rabbit anti-S100P monoclonal antibody (ZR115) been validated for use?
This antibody has been validated for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.
What are the available sizes and concentrations for the rabbit anti-S100P monoclonal antibody (ZR115)?
The antibody is available in 0.1 mL, 0.5 mL, and 1.0 mL concentrated formats as well as a 7 mL prediluted format.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.