Immunohistochemistry (IHC) : Formalin-fixed and paraffin-embedded human head and neck small cell carcinoma stained with anti-RRM1 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells

rabbit anti-RRM1 monoclonal antibody (ZR114) 6356

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to RRM1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Breast or colon carcinoma
Visualization: cytoplasm
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6356parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, General & Epithelial Markers, RRM1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-RRM1 monoclonal antibody ZR114 6356

antibody
Database link: human P23921
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Breast or colon carcinoma
Immunogen Synthetic peptide corresponding to residues within aa700-800 of human RRM1
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens RRM1 Ribonucleoside-diphosphate reductase large subunit
Protein names Ribonucleoside-diphosphate reductase large subunit
Alternative names Ribonucleoside-diphosphate reductase subunit M1, Ribonucleotide reductase large subunit
Gene names RRM1
Protein family Belongs to the ribonucleoside diphosphate reductase large chain family
Function Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides
Catalytic activity a 2'-deoxyribonucleoside 5'-diphosphate + [thioredoxin]-disulfide + H2O = a ribonucleoside 5'-diphosphate + [thioredoxin]-dithiol
Subcellular location Cytoplasm
Structure Heterodimer of a large and a small subunit. Heterodimer with small subunit RRM2 or RRM2B. The heterodimer with RRM2 has higher catalytic activity than the heterodimer with RRM2B. Interacts with AHCYL1 which inhibits its activity
Involvement in disease Progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal recessive 6 A form of progressive external ophthalmoplegia, a mitochondrial myopathy characterized by progressive paralysis of the levator palpebrae, orbicularis oculi, and extraocular muscles. Ragged red fibers are seen on muscle biopsy.
Keywords 3D-structure, Acetylation, Allosteric enzyme, ATP-binding, Cytoplasm, Deoxyribonucleotide synthesis, Disulfide bond, Nucleotide-binding, Oxidoreductase, Phosphoprotein, Primary mitochondrial disease, Progressive external ophthalmoplegia, Proteomics identification, Reference proteome
Sequence MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKST LDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHK EDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD EVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKI IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGAL EASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIA PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQII ACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCS LENRDECLMCGS
UniProt accession: P23921

Data

Formalin-fixed and paraffin-embedded human head and neck small cell carcinoma stained with anti-RRM1 antibody using peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-RRM1 monoclonal antibody (ZR114) validated for?

This antibody is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

How should the rabbit anti-RRM1 monoclonal antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C, and for longer-term storage, store it at -20°C while avoiding freeze/thaw cycles to preserve antibody integrity.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.