Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human liver with metastatic melanoma stained with anti-PRAME antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining in tumor cells

rabbit anti-PRAME monoclonal antibody (ZR383) 6345

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PRAME
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Testis or melanoma
Visualization: Nucleus, cytoplasm, cell surface, chromosome, Golgi apparatus.
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6345parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Dermatopathology, monoclonal, PRAME

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PRAME monoclonal antibody ZR383 6345

antibody
Database link: human P78395
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Testis or melanoma
Immunogen Recombinant fragment (around aa100-509) of human PRAME protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens PRAME Melanoma antigen preferentially expressed in tumors
Protein names Melanoma antigen preferentially expressed in tumors
Alternative names Opa-interacting protein 4, Preferentially expressed antigen of melanoma
Gene names PRAME
Protein family Belongs to the PRAME family
Function Substrate-recognition component of a Cul2-RING (CRL2) E3 ubiquitin-protein ligase complex, which mediates ubiquitination of target proteins, leading to their degradation (PubMed:21822215, PubMed:26138980). The CRL2(PRAME) complex mediates ubiquitination and degradation of truncated MSRB1/SEPX1 selenoproteins produced by failed UGA/Sec decoding (PubMed:26138980). In the nucleus, the CRL2(PRAME) complex is recruited to epigenetically and transcriptionally active promoter regions bound by nuclear transcription factor Y (NFY) and probably plays a role in chromstin regulation (PubMed:21822215). Functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG: prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis (PubMed:16179254)
Subcellular location Nucleus, Chromosome, Cytoplasm, Golgi apparatus, Cell membrane
Structure Component of a CRL2 E3 ubiquitin-protein ligase complex, also named ECS (Elongin BC-CUL2/5-SOCS-box protein) complex, composed of CUL2, Elongin BC (ELOB and ELOC), RBX1 and substrate-specific adapter PRAME (PubMed:21822215, PubMed:23460923, PubMed:26138980). Interacts with RARA (via the ligand-binding domain); the interaction is direct and ligand (retinoic acid)-dependent (PubMed:16179254). Interacts with EZH2; required to repress RAR signaling (PubMed:16179254)
Keywords Apoptosis, Cell membrane, Chromosome, Cytoplasm, Differentiation, Golgi apparatus, Growth regulation, Leucine-rich repeat, Membrane, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Repressor, Transcription, Transcription regulation, Ubl conjugation pathway
Sequence MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAA FDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ VLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVD LFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEV TCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQA LYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVM LTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI SALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMV WLSANPCPHCGDRTFYDPEPILCPCFMPN
UniProt accession: P78395

Data

Formalin-fixed, paraffin-embedded human liver with metastatic melanoma stained with anti-PRAME antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining in tumor cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-PRAME monoclonal antibody (ZR383) specifically react with?

This antibody is reactive with human species only.

Which applications is the rabbit anti-PRAME monoclonal antibody (ZR383) validated for?

It is suitable for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for the rabbit anti-PRAME monoclonal antibody (ZR383)?

Short-term storage should be at 2-8°C, while long-term storage is recommended at -20°C. Avoid freeze/thaw cycles to maintain antibody integrity.

What is the host species and clonality of the anti-PRAME antibody ZR383?

The antibody is a rabbit monoclonal antibody of the IgG isotype.

What concentrations and sizes are available for the rabbit anti-PRAME monoclonal antibody (ZR383)?

Available sizes include 0.1 mL, 0.5 mL, and 1.0 mL in concentrated form, as well as 7 mL in prediluted form.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.