Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human melanoma stained with anti-S-100B antibody using peroxidase conjugate and DAB chromogen. Note intense nuclear and cytoplasmic staining of melanoma cells

rabbit anti-S100B monoclonal antibody (ZR379) 6358

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to S100B
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Melanoma or brain
Visualization: Cytoplasmic and nucleus
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6358parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Dermatopathology, S100B

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-S100B monoclonal antibody ZR379 6358

antibody
Database link: human P04271
Tested applications IHC
Recommended dilutions Concentrated 1:150-300
Application Notes Positive control: Melanoma or brain
Immunogen Recombinant fragment (around aa3-92) of human S100B protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens S100B Protein S100-B
Protein names Protein S100-B
Alternative names S-100 protein beta chain, S-100 protein subunit beta, S100 calcium-binding protein B
Gene names S100B
Protein family Belongs to the S-100 family
Function Small zinc- and- and calcium-binding protein that is highly expressed in astrocytes and constitutes one of the most abundant soluble proteins in brain (PubMed:20950652, PubMed:6487634). Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer (PubMed:20950652, PubMed:6487634). Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites (By similarity). Acts as a neurotrophic factor that promotes astrocytosis and axonal proliferation (By similarity). Involved in innervation of thermogenic adipose tissue by acting as an adipocyte-derived neurotrophic factor that promotes sympathetic innervation of adipose tissue (By similarity). Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase (By similarity). Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization (PubMed:20351179). May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity (PubMed:22399290)
Subcellular location Cytoplasm, Nucleus, Secreted
Structure Dimer of either two alpha chains, or two beta chains, or one alpha and one beta chain (PubMed:12480931, PubMed:20950652). The S100B dimer binds two molecules of STK38 (By similarity). Interacts with CACYBP in a calcium-dependent manner (By similarity). Interacts with ATAD3A; this interaction probably occurs in the cytosol prior to ATAD3A mitochondrial targeting (PubMed:20351179). Interacts with S100A6 (PubMed:9925766). The S100B dimer interacts with two molecules of CAPZA1 (PubMed:12480931). Interacts with AGER (PubMed:20943659). Interacts with PPP5C (via TPR repeats); the interaction is calcium-dependent and modulates PPP5C activity (PubMed:22399290). Interacts with TPPP; this interaction inhibits TPPP dimerization (PubMed:33831707). Interacts with isoform CLSTN3beta of CLSTN3; interaction promotes secretion (By similarity)
Keywords 3D-structure, Acetylation, Calcium, Cell adhesion, Cytoplasm, Direct protein sequencing, Metal-binding, Nucleus, Proteomics identification, Reference proteome, Repeat, Secreted, Zinc
Sequence MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
UniProt accession: P04271

Data

Formalin-fixed, paraffin-embedded human melanoma stained with anti-S-100B antibody using peroxidase conjugate and DAB chromogen. Note intense nuclear and cytoplasmic staining of melanoma cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-S100B monoclonal antibody (ZR379) specifically react with?

This antibody specifically reacts with human S100B protein.

Which applications is this rabbit anti-S100B monoclonal antibody validated for?

It is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for maintaining the stability of this antibody?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C, avoiding repeated freeze/thaw cycles.

What is the immunogen used to generate the rabbit anti-S100B monoclonal antibody (ZR379)?

The immunogen is a recombinant fragment of human S100B protein, approximately amino acids 3 to 92.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.