Immunohistochemistry (IHC) : Human malignant melanoma stained with anti-SOX-10 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

mouse anti-SOX-10 monoclonal antibody (ZM10) 6365

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to SOX-10
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2b
Control: Melanoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6365parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Dermatopathology, SOX-10

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2b
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-SOX-10 monoclonal antibody ZM10 6365

antibody
Database link: human P56693
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Melanoma
Immunogen Recombinant human SOX10 protein fragment (around aa 115-269)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2b
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2b - Isotype Control

target relevance
Homo sapiens SOX10 Transcription factor SOX-10
Protein names Transcription factor SOX-10
Gene names SOX10
Function Transcription factor that plays a central role in developing and mature glia (By similarity). Specifically activates expression of myelin genes, during oligodendrocyte (OL) maturation, such as DUSP15 and MYRF, thereby playing a central role in oligodendrocyte maturation and CNS myelination (By similarity). Once induced, MYRF cooperates with SOX10 to implement the myelination program (By similarity). Transcriptional activator of MITF, acting synergistically with PAX3 (PubMed:21965087). Transcriptional activator of MBP, via binding to the gene promoter (By similarity)
Subcellular location Cytoplasm, Nucleus, Mitochondrion outer membrane
Structure Monomer. Interacts with ARMCX3 at the mitochondrial outer membrane surface. Interacts with PAX3 (PubMed:21965087)
Involvement in disease Waardenburg syndrome 2E An autosomal dominant auditory-pigmentary disorder characterized by sensorineural deafness, pigmentary disturbances of the hair, skin and eyes, and absence of dystopia canthorum which is the lateral displacement of the inner canthus of each eye. Individuals with WS2E may have neurologic abnormalities, including mental impairment, myelination defects, and ataxia. Some patients can manifest features of Kallmann syndrome. Waardenburg syndrome 4C A disorder characterized by the association of Waardenburg features (depigmentation and deafness) with the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease). Peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome and Hirschsprung disease A complex neurocristopathy that includes features of 4 distinct syndromes: peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome and Hirschsprung disease.
Keywords Activator, Alternative splicing, Cytoplasm, Deafness, Disease variant, DNA-binding, Hirschsprung disease, Kallmann syndrome, Membrane, Mitochondrion, Mitochondrion outer membrane, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Waardenburg syndrome
Sequence MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQD GEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARR KLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKN GKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT PPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQY LPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTET AGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASG LYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP
UniProt accession: P56693

Data

Human malignant melanoma stained with anti-SOX-10 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the mouse anti-SOX-10 monoclonal antibody (ZM10) specifically react with?

This antibody specifically reacts with human SOX-10 protein.

How should the mouse anti-SOX-10 monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term storage, it should be stored at -20°C. Freeze-thaw cycles should be avoided to preserve antibody integrity.

What is the recommended dilution range for using the concentrated form of this antibody in immunohistochemistry?

The recommended dilution for the concentrated mouse anti-SOX-10 monoclonal antibody in immunohistochemistry is 1:100 to 1:200.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.