Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human neuroblastoma stained with anti-PHOX2B antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells

rabbit anti-PHOX2B monoclonal antibody (ZR292) 6334

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PHOX2B
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Neuroblastoma
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6334parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, Neuropathology/Endocrine, PHOX2B

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PHOX2B monoclonal antibody ZR292 6334

antibody
Database link: human O14601
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Neuroblastoma
Immunogen Recombinant fragment of human PHOX2B protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens PHOX2B Paired mesoderm homeobox protein 2B
Protein names Paired mesoderm homeobox protein 2B
Alternative names Neuroblastoma Phox, PHOX2B homeodomain protein, Paired-like homeobox 2B
Gene names PHOX2B
Protein family Belongs to the paired homeobox family
Function Involved in the development of several major noradrenergic neuron populations, including the locus coeruleus. Transcription factor which could determine a neurotransmitter phenotype in vertebrates. Enhances second-messenger-mediated activation of the dopamine beta-hydrolase and c-fos promoters, and of several enhancers including cAMP-response element and serum-response element
Subcellular location Nucleus
Structure Interacts with TRIM11
Involvement in disease Central hypoventilation syndrome, congenital, 1 An autosomal dominant form of congenital central hypoventilation syndrome, a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. Neuroblastoma 2 A common neoplasm of early childhood arising from embryonic cells that form the primitive neural crest and give rise to the adrenal medulla and the sympathetic nervous system.
Keywords 3D-structure, Activator, Developmental protein, Disease variant, DNA-binding, Homeobox, Nucleus, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Triplet repeat expansion
Sequence MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSL TPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAET HYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSGKKSDSSR DDESKEAKSTDPDSTGGPGPNPNPTPSCGANGGGGGGPSPAGAPGAAGPGGPGGEPGKGG AAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPITSIPDSLGGPFASVLSSLQR PNGAKAALVKSSMF
UniProt accession: Q99453

Data

Formalin-fixed, paraffin-embedded human neuroblastoma stained with anti-PHOX2B antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-PHOX2B monoclonal antibody (ZR292) specifically react with?

The rabbit anti-PHOX2B monoclonal antibody (ZR292) is reactive with human tissues.

How should the rabbit anti-PHOX2B antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C, and for long-term storage, freeze it at -20°C while avoiding repeated freeze/thaw cycles.

What applications is the rabbit anti-PHOX2B monoclonal antibody validated for, and what are the recommended dilution ranges?

This antibody is validated for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues, with recommended dilutions of 1:100 to 1:200 for the concentrated form.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.