Immunohistochemistry (IHC) : Human lung adenocarcinoma stained with anti-PD-L1 (Clone ZR3) using peroxidase-conjugate and DAB chromogen. Note membranous staining of tumor cells.

rabbit anti-PD-L1 monoclonal antibody (ZR3) 6328

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PD-L1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Placenta or lung adenocarcinoma
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6328parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, General & Epithelial Markers, monoclonal, PD-L1

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PD-L1 monoclonal antibody ZR3 6328

antibody
Database link: human Q9NZQ7
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Placenta or lung adenocarcinoma
Immunogen KLH-conjugated linear peptide corresponding tohuman PD-L1
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CD274 Programmed cell death 1 ligand 1
Protein names Programmed cell death 1 ligand 1
Alternative names B7 homolog 1
Gene names CD274
Protein family Belongs to the immunoglobulin superfamily. BTN/MOG family
Function Plays a critical role in induction and maintenance of immune tolerance to self (PubMed:11015443, PubMed:28813410, PubMed:28813417, PubMed:31399419). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response (PubMed:11015443, PubMed:28813410, PubMed:28813417, PubMed:36727298). Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10) (PubMed:10581077). Can also act as a transcription coactivator: in response to hypoxia, translocates into the nucleus via its interaction with phosphorylated STAT3 and promotes transcription of GSDMC, leading to pyroptosis (PubMed:32929201)
Subcellular location Secreted
Structure May form homomultimers
Post-translational modification Ubiquitinated; STUB1 likely mediates polyubiquitination of PD-L1/CD274 triggering its degradation (PubMed:28813410). Ubiquitinated by MARCHF8; leading to degradation (PubMed:34183449). Deubiquitinated by USP22; leading to stabilization (PubMed:31399419)
Involvement in disease Autoimmune disease, multisystem, infantile-onset, 5 An autosomal recessive disorder characterized by autoimmune manifestations apparent in the first months or years of life. ADMIO5 patients have complete insulin deficiency and type 1 diabetes mellitus with neonatal onset.
Keywords 3D-structure, Adaptive immunity, Alternative splicing, Cell membrane, Diabetes mellitus, Disulfide bond, Endosome, Glycoprotein, Immunity, Immunoglobulin domain, Membrane, Nucleus, Proteomics identification, Receptor, Reference proteome, Repeat, Secreted, Signal, Transmembrane, Transmembrane helix, Ubl conjugation
Sequence MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
UniProt accession: Q9NZQ7

Data

Human lung adenocarcinoma stained with anti-PD-L1 (Clone ZR3) using peroxidase-conjugate and DAB chromogen. Note membranous staining of tumor cells.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-PD-L1 monoclonal antibody (ZR3) specifically react with?

This antibody specifically reacts with human PD-L1 protein.

Which applications is this PD-L1 antibody validated for?

The rabbit anti-PD-L1 monoclonal antibody (ZR3) is validated for immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded (FFPE) tissue samples.

What are the recommended storage conditions for the rabbit anti-PD-L1 monoclonal antibody (ZR3)?

For short-term storage, keep the antibody at 2-8°C; for long-term storage, it should be kept at -20°C. Avoid repeated freeze/thaw cycles to maintain antibody integrity.

What is the host species and clonality of the PD-L1 antibody (ZR3)?

The antibody is a rabbit monoclonal antibody, indicating it is derived from a single clone of rabbit B cells.

What positive controls are suggested for use with this anti-PD-L1 antibody in immunohistochemistry?

Placenta or lung adenocarcinoma tissues are recommended positive controls for validating staining with this anti-PD-L1 antibody in IHC assays.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.